Entry information : CclPrx113 (clementine0.9_034335m / nd[1.0])
Entry ID 8674
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-04-15 (Christophe Dunand)
Peroxidase information: CclPrx113 (clementine0.9_034335m / nd[1.0])
Name (synonym) CclPrx113 (clementine0.9_034335m / nd[1.0])
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx113
start..stop
S start..stop
CclPrx84 624 0 1..318 1..319
RcPrx52 510 0 1..318 1..317
PtPrx40 499 1.06e-179 7..318 51..360
PpePrx51 495 1.25e-178 1..319 1..320
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8674' 'complement(join(642926..643311,643855..644020,644439..644630,645299..645511))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 645299..645511 211 N° 2 644439..644630 190 N° 3 643855..644020 164 N° 4 642926..643311 384
complement(join(642926..643311,643855..644020,644439..644630,645299..645511))


exon

Literature and cross-references CclPrx113 (clementine0.9_034335m / nd[1.0])
DNA ref. Phytozome 12:   scaffold_5 (12942305..12944890)
Protein sequence: CclPrx113 (clementine0.9_034335m / nd[1.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (294)
PWM (Da):   %s   34104.74 (31292.4)  
PI (pH):   %s   6.97 (6.61) Peptide Signal:   %s   cut: 25 range:25-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSHSHLYGTCFIMFLLLSKLAFAQLSSNHYDNTCPKALSTIKSIVHNAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKSASANANSIRGFEVIDSVKSKVESLCPGVVS
CADILAVAARDSVVAFGGPSWTVQLGRRDSTTASSSAVNTNIPSPLMDLNDLISNFAKKGLSAKEMVALSGAHTIGQARCLLFRQRIYNETNIDSEFATSLKSNCPSSGGDDNLSSLDAT
SPVLFDNGYFRDLVNNKGVFHSDQQLFNGGSTDSQVTTYSTNIGTFYADFANAMVKMGNLSPLTGTDGQIRTNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCATCTCACTCACATCTTTATGGAACTTGCTTCATCATGTTTTTGTTGTTATCTAAACTGGCCTTTGCACAATTATCCTCAAATCACTATGATAATACTTGCCCAAAAGCCCTCTCT
ACCATCAAGTCTATAGTGCACAATGCAGTGGTAAAGGAGCATCGAATGGGAGCTTCTTTGCTTCGTCTCCATTTCCACGATTGTTTTGTTAAT
GCACGTTCTATCTCTCCCTCTCTCTTT
CTTTTCACTTTCAACGAAAGCGATTTGCAATTGCAAACTTGCATGCATGCATCCACCCAAAACGCATAATAGAGTTTCATTTACGCATTATCATAGTAATGCTTGAGTGACAAACTTTCT
TTGTATATGTTATTTAATTTGTACATAGTGAGGTGCTAAAACAGTATTAATTAGTAGAATAATAACTCAAAATAATCTCTTTTCATTAGCTATTTTTGTTGAGGTAAATGCTCCTTATAA
TTTAGATCAAGTCCCAAATATTTTCAAAATTAAAATTTTCCAAAAAGTCCAGTTGTCTGTTTGTTTATGTTAAAATTTACTTAATTATCATCTATTTTTCACCTGTTATATGTTAGATTT
ATTTGAATTTTAAGTTATATATCATGCAAAAATACTACTTTACTCTTAAATATTAAATCGGATTGCTACAATAGTAACAACATACGTGTATTACGGTAACTTTTTTTTAGGGATGAACTG
AATAATTAGCTCAAACCACATATAAAACTGAAGGAAATTTACTATTAATACATTTTTGTTATCAATATGGTTATATTACAATTTGATTAGTTGGGCATATGATAGTGTATTACGGTAACN
NNNNNNNNNNNNNNNNNNNNCGTTTATGCCTCAATTTGCAGGGGGTTGTGATGCATCAGTTCTATTAGATGACACTTCAAGTTTTACTGGTGAGAAATCAGCCAGCGCCAATGCGAATTC
AATAAGAGGCTTCGAAGTGATCGATTCAGTTAAATCTAAAGTTGAGAGTCTCTGCCCTGGTGTTGTTTCTTGTGCAGACATCTTAGCTGTTGCTGCTCGAGATTCCGTTGTTGCT
GTAAG
TGAAGTGAAAATTGCATTAACGACTACTTGAGATTATTGTCACCTAATAGTAATAACTGCAGGCCCAAAATCTTAGCACTTTTCTTTATTATTATTGTTGGATCCTTATCATCGACTTAG
GCTTAATTTTGGTTAAACGGTTTCTCTAACACAATTAAATTCAATTCTCTCAACTTATAAACTCATTCAATTTCTTGATTCACTTTTAAGCTCGTCTTTTGGTACATCCAAAACCTTTTT
CTTTTTCCCTTTTTTTTCTTTTTTCCTAATCTTAGCCTACAAACATTTCACATAAGGAAGCACATGAAACCCTATCTTATCAGCTTAAACTTTTGGCTAAGCAGTTATTAACAGTATAAT
GGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGATATTCTTTTTTGTTCAGTTTTCGGGGGGCCTTCATGGACAGTTCAATTAGGTAGAAGAGATTCGACAACGGCAAGTTCCAGTGC
AGTAAATACTAATATTCCATCCCCTCTCATGGATCTTAATGACCTTATTTCTAACTTTGCAAAGAAAGGACTCAGTGCTAAAGAAATGGTGGCCCTCTCAG
GTAATAAAATTATTATTAG
ATTAATAAACTTAGACCTTGTGCTGATCTAAGCTGCACTAATCTTTCAAAATCATATCTCATCACCTGCACAACCAAAAAAGGCCTCTAGTATCAGTGGATGTACGAGTGCATTAATAAC
ATTGTACGCATGGTAGAATTTAGTTACATATATATACCGTGTAGAATGATCAACATAAGATTAGATAAATATTGATATGTATTGAAGATATTATCTCACATCAACTGAGAATAATTACTA
GGTTAATAACATAAGTGAGGCAATCCTCAAATCCTAAGCCATTTTCGGAGTATAAGTTAGGCTCATCAGTTTTTTATATGGTATCAGAGTTAGAGTCAATTACGAGTGGGATCACTCTAC
TTTATCGTGTGATAAGGACTAGCTAGGCAAAAAAATCCGTATTGAGGAGAATATTCCAAGTCAACTATTAACTCAACTAGCTAGCTAGTAGCCATATTCTTTGACGTCTATAATTCTTAT
TTCGTGTATGATTAATTATATATCAAAATTCTGGTCATATACAGGAGAGCTCACACAATAGGACAAGCTAGGTGCTTATTGTTTCGACAAAGAATCTACAATGAAACAAACATTGATTCA
GAATTTGCAACATCATTAAAATCAAACTGCCCAAGCTCAGGCGGCGATGACAACCTTTCTTCATTAGATGCCACCAGCCCTGTCCTATTTGACAATGGCTATTTCCGGGACTTGGTGAAT
AACAAAGGTGTCTTTCATTCAGACCAGCAGCTCTTCAATGGCGGCTCAACTGACTCTCAAGTCACCACTTACAGCACCAACATTGGAACGTTTTATGCAGATTTCGCCAATGCAATGGTC
AAAATGGGGAACCTTAGCCCACTTACGGGGACTGATGGGCAGATTCGCACCAACTGCCGCAAAATAAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCATCTCACTCACATCTTTATGGAACTTGCTTCATCATGTTTTTGTTGTTATCTAAACTGGCCTTTGCACAATTATCCTCAAATCACTATGATAATACTTGCCCAAAAGCCCTCTCT
ACCATCAAGTCTATAGTGCACAATGCAGTGGTAAAGGAGCATCGAATGGGAGCTTCTTTGCTTCGTCTCCATTTCCACGATTGTTTTGTTAAT
GGTTGTGATGCATCAGTTCTATTAGAT
GACACTTCAAGTTTTACTGGTGAGAAATCAGCCAGCGCCAATGCGAATTCAATAAGAGGCTTCGAAGTGATCGATTCAGTTAAATCTAAAGTTGAGAGTCTCTGCCCTGGTGTTGTTTCT
TGTGCAGACATCTTAGCTGTTGCTGCTCGAGATTCCGTTGTTGCT
TTCGGGGGGCCTTCATGGACAGTTCAATTAGGTAGAAGAGATTCGACAACGGCAAGTTCCAGTGCAGTAAATACT
AATATTCCATCCCCTCTCATGGATCTTAATGACCTTATTTCTAACTTTGCAAAGAAAGGACTCAGTGCTAAAGAAATGGTGGCCCTCTCAG
GAGCTCACACAATAGGACAAGCTAGGTGC
TTATTGTTTCGACAAAGAATCTACAATGAAACAAACATTGATTCAGAATTTGCAACATCATTAAAATCAAACTGCCCAAGCTCAGGCGGCGATGACAACCTTTCTTCATTAGATGCCACC
AGCCCTGTCCTATTTGACAATGGCTATTTCCGGGACTTGGTGAATAACAAAGGTGTCTTTCATTCAGACCAGCAGCTCTTCAATGGCGGCTCAACTGACTCTCAAGTCACCACTTACAGC
ACCAACATTGGAACGTTTTATGCAGATTTCGCCAATGCAATGGTCAAAATGGGGAACCTTAGCCCACTTACGGGGACTGATGGGCAGATTCGCACCAACTGCCGCAAAATAAACTGA

Retrieve as FASTA