1. Browse the Database
  2. View Redoxidase
Entry information : SbPrx107 (SSobic.008G114700.1 [2.1] / Sb08g016840 [1.4])
Entry ID 868
Creation 2008-10-21 (Christophe Dunand)
Last sequence changes 2008-10-21 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx107 (SSobic.008G114700.1 [2.1] / Sb08g016840 [1.4])
Name (synonym) SbPrx107 (SSobic.008G114700.1 [2.1] / Sb08g016840 [1.4])
Class Class III peroxidase    [Orthogroup: Prx194]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Nitrogen starvation
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx107
start..stop		 S start..stop
ZmPrx72 526 0 1..342 7..354
TaPrx150-1A 513 0 38..343 29..331
TaPrx150-1D 494 1.82e-177 38..343 29..331
SofPrx05 461 6.06e-165 1..286 11..296
Gene structure Fichier Exons►


exon

Literature and cross-references SbPrx107 (SSobic.008G114700.1 [2.1] / Sb08g016840 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_8 (45028880..45022922)
EST ref. GenBank:   CF434202 [5' end]  CN150521 [5' end]
Protein sequence: SbPrx107 (SSobic.008G114700.1 [2.1] / Sb08g016840 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (320)
PWM (Da):   %s   35917.49 (33299.0) Transmb domain:   %s   i9-31o
PI (pH):   %s   8.99 (8.81) Peptide Signal:   %s   cut: 27 range:27-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPTSSPPLVVVRLLASAVATMLVLASGGGVCDGAALKAHFYRRS
CPAAEAVVRDIVVARVAADPAALPAKLLRLFFHDCFVRGCDASVLLDSTAGNTAEKDAAPNGSLGGFDVIDTAKAVLEAICPGTVSCADIVALAARDAVSLQLGRDLWDVQLGRRDGVVSRASEALADIPSPSDNFTTLEARFGSKGLDVKDLVILSG
AHTIGVAHCNTFASRLSGFGSSNSGADPTLNAAYAAQLRSRCGPAPVASSNNVTAVTMDPGSPAGRFDAHYYVNLKLGRGLFASDAALLADRRAAAMIHRLTRKGYFLQEFRNAVRKMGR
VGVRTGGRGEIRRNCRAVNSDAM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, introns 1 and 3) and 5 ESTs. long intron...
DNA ►
Send to BLAST
CDS►
Send to BLAST