Entry information : CclPrx119 ( clementine0.9_035853m)
Entry ID 8680
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-14 (Christophe Dunand)
Peroxidase information: CclPrx119 ( clementine0.9_035853m)
Name (synonym) CclPrx119 ( clementine0.9_035853m)
Class Class III peroxidase     [Orthogroup: Prx041]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx119
start..stop
S start..stop
CsPrx[P]64 537 0 1..337 1..319
PpePrx23 375 8e-131 4..337 1..332
CsaPrx88 359 2e-124 1..337 1..331
PtPrx83 351 3e-121 28..337 33..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1054401..1054616 216 N° 2 1054743..1054949 207 N° 3 1055338..1055503 166 N° 4 1055610..1056031 422
join(1054401..1054616,1054743..1054949,1055338..1055503,1055610..1056031)


exon

Literature and cross-references CclPrx119 ( clementine0.9_035853m)
DNA ref. Phytozome 12:   scaffold_61 (1054401..1056031)
Protein sequence: CclPrx119 ( clementine0.9_035853m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (312)
PWM (Da):   %s   38188.91 (35510.4)  
PI (pH):   %s   9.08 (8.81) Peptide Signal:   %s   cut: 24 range:24-335
Sequence 378
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MENIRILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIIRRIVENAVVKDPRMAASLLRLHFHDCFIAARDAVALVCNVTLSTFRFVDIRAYSTLNLKAYLTFLIPERISKRRSRLCHCLYSADYNKLRCFGMRIRGGLTWKVLLGRTDSLKASFDGAKKYIPFPNSSLETLIANFEHQGLDIRDLVALSGSHTIGEARCLSFRQSIYDVNIKEEHYDKYKI*TTFRRIVRSICPESGRDNEVAPLDYTTPARFGNH*YLNILRGRGLLPSDNLLVTQDHRQGEIIQLVWAHASDQQFFCDSFVNSIVKVGKINVLTGHHGQIRNDCRFVN

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Incorrect prediction from phytozome(Short 5' end and some short seqs in frame are missing which have been completed manually).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGAATATAAGGATACTATTGTTGATTGTATTGATGTTCATGTTGCATGGAAGAAAGATTTCGGGTGAAGGTGATGGAGTTCTTGTTCAGGATTACTACAAAGAGACATGCCCCTTAG
CAGAAGAGATTATCAGACGTATTGTCGAGAATGCCGTGGTTAAAGATCCTCGCATGGCAGCATCACTCCTACGCTTGCACTTTCATGATTGCTTT
CTCATGGTTACATTTGATCCCATCA
TCTCTCTTATCTGTGTGAGGATTCGAAGTGATTGATGAGATCAAGTTCATTTTAGAAGATGCATGTCCCCACACAATTTCATGTGCTCTGATATTCTAACCATTGCCGCTCGTGATGCTG
TTGCTTTGGTATGTAATGTAACTCTCTCCACATTTCGTTTTGTAGATATTCGTGCATATTCAACATTAAATCTGAAAGCGTACCTAACCTTTTTGATCCCCGAACGCATCTCCAAACGCA
GAAGCAGGTTATGTCACTGTCTCTATTCAGCGGATTACAATAAGTTACGTTGCTTTGGCATGAGAATT
TAAGGAAAAATCCTCATGCCAATGTATGTTTATGCCAATGTTTATCGATTCG
ATCCGAGATCTATTATTGTATGTTTAGCCAATGTTTGTTGGGATATTACTATCGATTCGATAGCTATTATTGTATTTTCTAATACGTTATATATACTTCCATGTCTTATATAAACTTCCA
TGTCTCTCACATACAAAATTTAGGTACAATATGTGTATTTATATAAAAGCTAATGTAAGTGATAGAAGTTAAAATAAAAGACTTCATAACTCTTAGAGTTCAATTAGACTTGCAATAATG
ATATAGATTGTTGTTTATGTTCGGCCGGGCCAACTCCAATGCTTCTCTTACAAGTTTAGTGATATACTTACAAGCCTCTGACTTTTATATTATCAGAGAGGAGGACTGACATGGAAGGTC
TTGCTTGGAAGGACAGATTCACTGAAAGCGAGCTTTGACGGAGCCAAAAAGTACATTCCTTTTCCCAATTCCTCTCTGGAGACTCTTATTGCAAATTTTGAACATCAAGGTCTTGACATT
AGAGACTTGGTTGCTTTATCAG
GTTCAATCAAAATAATGTGAATTAACAAGCCACTATCTTACATCCCAAGTTTCAAATTTTGTGGTAAAATGTTGAAATTGACTTGAAAAAAATAAACT
GTCAATAGGTAGCCACACAATTGGTGAGGCAAGATGTCTGAGCTTCAGGCAAAGTATCTATGACGTTAACATTAAAGAAGAACATTATGATAAATACAAAATATAAACAACATTTCGGAG
AATCGTACGGTCCATATGCCCTGAATCAGGAAGAGATAACGAAGTGGCGCCGCTTGATTATACGACTCCTGCAAGGTTTGGCAATCATTAGTACCTCAACATTCTTCGAGGAAGAGGTCT
GCTGCCATCAGATAATCTACTAGTGACTCAAGACCATCGTCAAGGAGAAATAATTCAGCTAGTGTGGGCACATGCCTCTGATCAACAATTCTTCTGTGATTCATTTGTAAATTCTATTGT
CAAGGTGGGAAAGATAAATGTACTCACTGGCCACCACGGGCAAATCAGGAACGACTGTAGGTTTGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGAATATAAGGATACTATTGTTGATTGTATTGATGTTCATGTTGCATGGAAGAAAGATTTCGGGTGAAGGTGATGGAGTTCTTGTTCAGGATTACTACAAAGAGACATGCCCCTTAG
CAGAAGAGATTATCAGACGTATTGTCGAGAATGCCGTGGTTAAAGATCCTCGCATGGCAGCATCACTCCTACGCTTGCACTTTCATGATTGCTTT
ATTGCCGCTCGTGATGCTGTTGCTT
TGGTATGTAATGTAACTCTCTCCACATTTCGTTTTGTAGATATTCGTGCATATTCAACATTAAATCTGAAAGCGTACCTAACCTTTTTGATCCCCGAACGCATCTCCAAACGCAGAAGCA
GGTTATGTCACTGTCTCTATTCAGCGGATTACAATAAGTTACGTTGCTTTGGCATGAGAATT
AGAGGAGGACTGACATGGAAGGTCTTGCTTGGAAGGACAGATTCACTGAAAGCGAGCT
TTGACGGAGCCAAAAAGTACATTCCTTTTCCCAATTCCTCTCTGGAGACTCTTATTGCAAATTTTGAACATCAAGGTCTTGACATTAGAGACTTGGTTGCTTTATCAG
GTAGCCACACAA
TTGGTGAGGCAAGATGTCTGAGCTTCAGGCAAAGTATCTATGACGTTAACATTAAAGAAGAACATTATGATAAATACAAAATATAAACAACATTTCGGAGAATCGTACGGTCCATATGCC
CTGAATCAGGAAGAGATAACGAAGTGGCGCCGCTTGATTATACGACTCCTGCAAGGTTTGGCAATCATTAGTACCTCAACATTCTTCGAGGAAGAGGTCTGCTGCCATCAGATAATCTAC
TAGTGACTCAAGACCATCGTCAAGGAGAAATAATTCAGCTAGTGTGGGCACATGCCTCTGATCAACAATTCTTCTGTGATTCATTTGTAAATTCTATTGTCAAGGTGGGAAAGATAAATG
TACTCACTGGCCACCACGGGCAAATCAGGAACGACTGTAGGTTTGTCAAT

Retrieve as FASTA