Entry information : CclPrx16 (clementine0.9_014487m)
Entry ID 8682
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx16 (clementine0.9_014487m)
Name (synonym) CclPrx16 (clementine0.9_014487m)
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx16
start..stop
S start..stop
CsPrx56 707 0 1..350 1..350
CclPrx68 620 0 1..350 1..349
CclPrx05 614 0 1..350 1..350
CsPrx52 613 0 1..350 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1059949..1060167 219 N° 2 1059049..1059240 192 N° 3 1058021..1058189 169 N° 4 1057340..1057812 473
complement(join(1057340..1057812,1058021..1058189,1059049..1059240,1059949..1060 167))


exon

Literature and cross-references CclPrx16 (clementine0.9_014487m)
DNA ref. Phytozome 12:   scaffold_31 (1060167..1057340)
Protein sequence: CclPrx16 (clementine0.9_014487m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (324)
PWM (Da):   %s   37981.25 (35383.8)  
PI (pH):   %s   8.58 (8.59) Peptide Signal:   %s   cut: 27 range:27-350
Sequence 391
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATLRYLLAAALVVAIALEGSSPSQAQLSPFFYSSTCPNVTNIIRGVLQKAFLSDIRIGASLIRLHFHDCFVNGCDASVLLDNTTTIDSEKFAAPNNNSARGFEVIDQMKAAVEKACPRVVSCADILTIAAEQSVALSGGPSWTNLLGRRDSRTANRTLANQNLPSPFDTLDRLKASFRNVGLNDNFDLVALSGAHTFGRAQCRFFSVRLFNFNNTGNPDPTLDATFLQQLRQLCPQGGNGSVLTNLDVTTPNVFDNKYFSNLRNRKGLLQSDQELFSTPGADTIDIVNVFRKNQAAFFKSFVTSMIRMGNLKPLTGNEGEIRLNCRRVNGNSNIVTRSSSSEGDTISSF

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACTCTGCGTTATCTTCTTGCAGCTGCTCTTGTAGTTGCTATTGCTCTTGAGGGATCATCACCATCTCAAGCTCAACTGTCTCCCTTTTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGAGGGGTGCTTCAGAAAGCTTTCTTGTCCGATATTCGTATCGGTGCCAGCCTTATCAGGCTTCATTTCCATGACTGTTTTGTTAAT
GTATCAATCTCTAATCTTTGT
TTTTTTCTTCTATTTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTCTTTAGTGGCTTTAAACAAAATATAGTTTTACTTAAAACCTAAAGAACA
GTTTGAATATGTCATTTTTAAAAATCCAAAACCCTTTTTATATATCTTTTGTTTTAATTGCTTTTACTTGTATGCTGCTTGTGCATCCTTGTTCTGCCCGCATATTCATAAATTTAAAGA
GACTTTTTCCCCCTAAAAGATCTGATTTTTTCAATTCATAGGACGATTTTTTCCTTTCTAATTTCGATGCACCGAAGGCCGTGTAATTTTTCAAAAAGACACTTATATATGTGATTTTCA
TACATTAGAAATTAAAATCAAATAAAGACTTAGCCTAAATCAAGGATTAAAATCCTCTAGTGATCTATTTCTTGTTGAGTGCTTTTGATGATGCCTTGAGTCTATTATTAATATAGTTTA
AAATTTAACTACTCCAACTGAAAAGCTTAAGTCGGGAGTAAATCCTAGTCTTGAAAACATATTTGACGATAAGACAATTACAATAAGAAGAGTTTGCGTTACTTTTTATTTATTTGTCAT
GAGATAAGAAGGAATCCATCAACTTATTAAATTAACGATACAACGACACTTAACATGACAAATTATTAATTAACAATATCATTTCAGGGCTGTGATGCATCAGTTTTGTTGGACAACACT
ACAACCATAGACAGTGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTTGAAGTTATTGATCAGATGAAAGCTGCCGTTGAAAAGGCCTGTCCAAGGGTTGTTTCCTGTGCT
GATATTCTTACTATTGCAGCTGAACAATCTGTTGCTTTG
GTACGAATTTTTATTAACAACTCCACTTCTTTAATAATAAAATAATTAGGGTAATTATCCATCAACCACTTGTTCNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTGAATTCTATTCGAATTATATTATTTTGCACATATACACTTCCGTCTCCAAATTGTTAAGAGAACTCATGGAATATTGTATAAATGACTT
TTTATCCCCAAATGTAAAATAACAATTATTCATCGACTACTTTTTTTTCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTGAACTCTACTTAAAGTTATATTAT
TTTGCACGTCCACTTTTGTTTTTTCGTCGTGAAATGATAATTTTACCTTTATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGATACGTGGATAATT
ACTCAAAAAATAATTCTCACGGAAAAATGGAAAAATTTTGAATCCACGTTTTTATTCTTGCATTTTTGCATGTGCATTTCAACGAGAAAACTACAAAAGTCTAAGATGTCATTGTCCTAC
CACGTGGTAATTGATTTAAAAGTTGTGATGGGATTCGTCATGGAACCGATCACTTTTAAGATCCCATCGTTTTCAACTATGACGTTGGATTTCATTACACGACAAAGCTTGATCCAAAAT
TTTATGGCGACGTGATAAGACTACCACATTATTAGCCAAATGATCCGACCCAAACACACACAAATTGAAAGCCCGAAAGATTAATTGTCTATTTCTGATTTTGATAAAATTTGCTTATTA
TACATCTCTTAAGTTTATTGCTGATCGTGAGTAATGAACTGAATGGTTTTGGTTACAGTCAGGGGGTCCTTCGTGGACAAATCTATTGGGAAGAAGAGACAGCAGAACAGCAAACAGAAC
TCTTGCAAATCAGAATCTTCCATCACCGTTTGATACTCTTGACAGGCTCAAAGCTAGTTTTAGAAATGTCGGCCTCAACGATAATTTTGATCTTGTTGCACTCTCCG
GTAATTATTTTGC
TTCTCGCCCTTTAATTTTAAGTAAAGTTATGAGAGTAAATTTTTAGAGGTCCAGGATTCCACGTGGAGCGGTCATCTAAATAAAGGTGGTCATGCTACAGCAAATTATGTTATTATCACT
AAGCGAATTATAATATTATTCCTTGTATGAATAGAGCAAGATTACAAGGATTTGCCGTGCATGTATAATTTTCAGGAGCTCACACATTTGGAAGGGCTCAGTGCCGATTTTTCAGCGTAA
GATTATTCAATTTCAACAACACTGGCAATCCAGACCCAACCCTAGACGCAACCTTCTTACAACAACTGAGGCAACTATGCCCACAAGGTGGAAACGGCAGCGTTCTAACAAATTTAGACG
TCACAACACCTAATGTTTTCGACAACAAATACTTCTCCAATCTCAGAAACCGCAAAGGCCTTCTGCAGAGTGATCAAGAGCTGTTTTCGACTCCCGGTGCCGATACCATTGACATTGTCA
ATGTCTTTCGCAAGAACCAGGCTGCTTTCTTTAAAAGCTTTGTGACTTCAATGATAAGAATGGGGAATTTGAAGCCACTGACGGGAAATGAAGGGGAGATTAGATTGAACTGCAGGAGGG
TCAATGGAAACAGCAATATCGTAACAAGATCATCATCGTCAGAGGGTGATACGATCAGCTCTTTCTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACTCTGCGTTATCTTCTTGCAGCTGCTCTTGTAGTTGCTATTGCTCTTGAGGGATCATCACCATCTCAAGCTCAACTGTCTCCCTTTTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGAGGGGTGCTTCAGAAAGCTTTCTTGTCCGATATTCGTATCGGTGCCAGCCTTATCAGGCTTCATTTCCATGACTGTTTTGTTAAT
GGCTGTGATGCATCAGTTTTG
TTGGACAACACTACAACCATAGACAGTGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTTGAAGTTATTGATCAGATGAAAGCTGCCGTTGAAAAGGCCTGTCCAAGGGTT
GTTTCCTGTGCTGATATTCTTACTATTGCAGCTGAACAATCTGTTGCTTTG
TCAGGGGGTCCTTCGTGGACAAATCTATTGGGAAGAAGAGACAGCAGAACAGCAAACAGAACTCTTGCA
AATCAGAATCTTCCATCACCGTTTGATACTCTTGACAGGCTCAAAGCTAGTTTTAGAAATGTCGGCCTCAACGATAATTTTGATCTTGTTGCACTCTCCG
GAGCTCACACATTTGGAAGG
GCTCAGTGCCGATTTTTCAGCGTAAGATTATTCAATTTCAACAACACTGGCAATCCAGACCCAACCCTAGACGCAACCTTCTTACAACAACTGAGGCAACTATGCCCACAAGGTGGAAAC
GGCAGCGTTCTAACAAATTTAGACGTCACAACACCTAATGTTTTCGACAACAAATACTTCTCCAATCTCAGAAACCGCAAAGGCCTTCTGCAGAGTGATCAAGAGCTGTTTTCGACTCCC
GGTGCCGATACCATTGACATTGTCAATGTCTTTCGCAAGAACCAGGCTGCTTTCTTTAAAAGCTTTGTGACTTCAATGATAAGAATGGGGAATTTGAAGCCACTGACGGGAAATGAAGGG
GAGATTAGATTGAACTGCAGGAGGGTCAATGGAAACAGCAATATCGTAACAAGATCATCATCGTCAGAGGGTGATACGATCAGCTCTTTCTA

Retrieve as FASTA