Entry information : CclPrx18 (clementine0.9_014516m)
Entry ID 8683
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-05 (Qiang Li)
Peroxidase information: CclPrx18 (clementine0.9_014516m)
Name (synonym) CclPrx18 (clementine0.9_014516m)
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx18
start..stop
S start..stop
CsPrx43 684 0 1..343 1..348
PtPrx88 440 2.45e-156 14..338 1..323
RcPrx68 430 1.95e-152 30..338 20..325
MePrx68 427 2.01e-151 31..338 21..325
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8683' 'complement(join(354578..354853,354878..355023,355107..355272,355360..355539,355955..356212))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 355955..356212 256 N° 2 355360..355539 178 N° 3 355107..355272 164 N° 4 354878..355023 144
N° 5 354578..354853 274  
complement(join(354578..354853,354878..355023,355107..355272,355360..355539,3559 55..356212))


exon

Literature and cross-references CclPrx18 (clementine0.9_014516m)
DNA ref. Phytozome 12:   scaffold_84 (356212..354578)
Protein sequence: CclPrx18 (clementine0.9_014516m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343
PWM (Da):   %s   36495.82  
PI (pH):   %s   7.95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSERVDHIWKTKKVKQAVALLILRQCLLANIAGLSHGALQVGFYRGKCGIADVEMIVAGVVTARFFRDPTVVAALIRLQFHDCFVNGCDASILIDATNSEKTAIPNLTIRGYDIIDEAKA
AVERFCPGVVSCADLIAIAARDAVFLGGGGRYEVQTGRRDGLVSLAQNVSISIPGPSASIPQTMAVFANKGLNLTDMVLLMGGHSVGVAHCSIFKDRLYNFRSTGRPDPTMDSFLANKLR
ARCPLDxxxxxxxVDLDQNPFQIPFLDNSYYRQLMLNRGVLEIDQELALHPLTRATVMSIANALDFPIQFGAAMVKMGAIEVLTGMQGEIRRFCTATNWPPFT

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phyozome (An extra short seq LDTTTT has been removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGAGAGTAGATCATATTTGGAAGACGAAGAAGGTGAAGCAGGCTGTGGCTTTGTTGATTCTCAGGCAGTGTTTATTAGCAAACATCGCAGGATTGAGCCATGGTGCATTACAGGTAGGA
TTTTACAGAGGAAAATGTGGGATTGCTGATGTTGAGATGATAGTAGCCGGTGTTGTCACAGCAAGGTTCTTCAGAGATCCCACTGTCGTGGCTGCCCTCATACGCTTGCAGTTTCATGAT
TGCTTTGTCAATGTAAGC
TTCCATTTTCCCAAGCATATATTCTTGCTTAAGTTTAGAACTGCATTGTTTGCATTCCATGCACCAACAAATACGCATAGTTAATCAATTTTATCTAGTCCT
TAAAACTTCTATGAAGCAAGAAACATTGACGCTGCATTGGTTGGTAAACATTCTTTGTGTGCACACCGCGCATGTTTCATTCTTTTATTTCTTTTATGTTCTTTAATTGCAAATGTTTCC
CGTCTATACTTTTATTATACAACGAATTAGACATACTGAATTGAAATTCATTAAATGGTCTACATACATTTGGAACTGGGTTTCTGCCTAGGAGTTTAATAAATCTGAACAATTATCTTG
ATATTTAAGCACTGATAAAACACAATATCAAACTAAATGCAAATCTGTGGGAATGGTGATGAGAAAGGGTTGCGAGACGCATCAATTCTTATAGATGCCACCAACAGCGAGAAAACAGCA
ATTCCAAATCTGACCATAAGGGGTTATGATATCATAGACGAAGCAAAGGCTGCTGTTGAAAGATTTTGTCCTGGTGTCGTTTCCTGTGCTGATCTCATTGCCATTGCTGCTAGAGATGCT
GTTTTCTTGGTACTT
AAAACTTTCTCTCTGCGCATGCCATATCTGCTATATATTCAATCAAACTCAAAATTACTGTAATTGACAATTGAACTGCAGGGCGGCGGGGAGGAAGATATGAGG
TGCAAACAGGAAGAAGAGACGGTTTAGTGTCTCTAGCTCAGAATGTGTCCATTTCTATCCCAGGTCCTTCAGCTTCGATCCCTCAGACTATGGCCGTGTTTGCTAACAAAGGCCTCAATC
TTACCGACATGGTTCTTCTGATGGGTATTT
AGCTTAAAACACTTTCAATGAAAGCACTTGAAAATTCTTGTGTTCATAATTTCCATTGCATTTTATGATTGCTTTAGGAGGTCACACTCT
GTAGGAGTAGCACATTGCTCAATCTTCAAAGATCGTCTCTACAATTTCAGAAGCACAGGCAGACCCGACCCCACAATGGATTCATTCCTCGCGAATAAGCTGAGAGCGCGGTGCCCTCTA
GACNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNCGNNNNNNNNGTTGATCTTGATCAAAATCCATTTCAAATTCCATTCCTGGACAATTCCTACTACAGACAGTTAATGCTAA
ACAGAGGAGTGCTCGAAATCGATCAAGAATTGGCATTACACCCATTGACAAGAGCCACTGTGATGAGCATAGCCAATGCCTTAGACTTTCCCATACAGTTTGGTGCTGCAATGGTGAAAA
TGGGAGCCATTGAAGTTCTCACTGGCATGCAAGGAGAGATTAGGAGATTCTGTACAGCCACAAATTGGCCACCATTTACATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGAGAGTAGATCATATTTGGAAGACGAAGAAGGTGAAGCAGGCTGTGGCTTTGTTGATTCTCAGGCAGTGTTTATTAGCAAACATCGCAGGATTGAGCCATGGTGCATTACAGGTAGGA
TTTTACAGAGGAAAATGTGGGATTGCTGATGTTGAGATGATAGTAGCCGGTGTTGTCACAGCAAGGTTCTTCAGAGATCCCACTGTCGTGGCTGCCCTCATACGCTTGCAGTTTCATGAT
TGCTTTGTCAATGTAAGC
GACGCATCAATTCTTATAGATGCCACCAACAGCGAGAAAACAGCAATTCCAAATCTGACCATAAGGGGTTATGATATCATAGACGAAGCAAAGGCTGCTGTT
GAAAGATTTTGTCCTGGTGTCGTTTCCTGTGCTGATCTCATTGCCATTGCTGCTAGAGATGCTGTTTTCTTGGTACTT
GGAGGAAGATATGAGGTGCAAACAGGAAGAAGAGACGGTTTA
GTGTCTCTAGCTCAGAATGTGTCCATTTCTATCCCAGGTCCTTCAGCTTCGATCCCTCAGACTATGGCCGTGTTTGCTAACAAAGGCCTCAATCTTACCGACATGGTTCTTCTGATGGGT
ATTT
ACTCTGTAGGAGTAGCACATTGCTCAATCTTCAAAGATCGTCTCTACAATTTCAGAAGCACAGGCAGACCCGACCCCACAATGGATTCATTCCTCGCGAATAAGCTGAGAGCGCGG
TGCCCTCTAGACNNNNNNNNNNNNNNNNNN
NNNGTTGATCTTGATCAAAATCCATTTCAAATTCCATTCCTGGACAATTCCTACTACAGACAGTTAATGCTAAACAGAGGAGTGCTCGAA
ATCGATCAAGAATTGGCATTACACCCATTGACAAGAGCCACTGTGATGAGCATAGCCAATGCCTTAGACTTTCCCATACAGTTTGGTGCTGCAATGGTGAAAATGGGAGCCATTGAAGTT
CTCACTGGCATGCAAGGAGAGATTAGGAGATTCTGTACAGCCACAAATTGGCCACCATTTACATAA

Retrieve as FASTA