Entry information : CclPrx21 ( clementine0.9_014719m)
Entry ID 8685
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-14 (Christophe Dunand)
Peroxidase information: CclPrx21 ( clementine0.9_014719m)
Name (synonym) CclPrx21 ( clementine0.9_014719m)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx21
start..stop
S start..stop
CsPrx26 702 0 1..345 1..345
BrPrx09-1Aa_other 566 0 1..345 1..347
ThasPrx40 562 0 1..345 1..346
AtPrx09 556 0 1..345 1..346
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1959393..1959659 267 N° 2 1959803..1959994 192 N° 3 1960093..1960258 166 N° 4 1960343..1960755 413
join(1959393..1959659,1959803..1959994,1960093..1960258,1960343..1960755)


exon

Literature and cross-references CclPrx21 ( clementine0.9_014719m)
DNA ref. Phytozome 12:   scaffold_22 (1959393..1960755)
EST ref. GenBank:   DY277100.1 [Fragment]
Protein sequence: CclPrx21 ( clementine0.9_014719m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (322)
PWM (Da):   %s   37280.15 (34809.6)  
PI (pH):   %s   7.98 (7.31) Peptide Signal:   %s   cut: 24 range:24-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFFKLAITLLLLALISARISLAHPGIGIGWGGNGQYGGSFYGLFPQFYQFSCPQVDNIVMSVLQKAIARQPRIAASLLRLHFHDCFVQGCDASVLLDDSAAIVSEKNSVPNRNSLRGFEVIDEIKAKLEEACPQTVSCADIVALAARGSVVLSGGPSWELPLGRRDSRTASLSGSNSNIPPPNSTVQNLIASFKRQGLNEVDLVSLSGGHTIGVARCVTFKQRLYNQNGNNQPDETLERTYYFGLKSVCPRTGGDNNISPLDFASPAKFDNTYFKLVLLGKGLLTSDEVLLTGDVGNIVQLVKSYAEDDELFFKQFAQSMVKMGNISPLTGFNGEVRKNCRLVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTTCAAATTGGCTATCACTCTACTGCTACTAGCTTTGATCTCAGCCAGGATCTCACTAGCTCACCCTGGAATTGGCATTGGCTGGGGTGGTAATGGCCAGTATGGAGGCAGC
TTCTATGGCCTCTTTCCACAATTTTATCAGTTTTCATGCCCACAAGTTGATAACATTGTCATGTCAGTGCTCCAGAAGGCCATTGCAAGACAGCCCAGAATAGCTGCCTCTTTGCTTAGG
CTTCATTTCCATGATTGCTTTGTTCAG
GTTTCTCACTTTTAGTATACCTAGTAGTACAAAACACTCGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAAGTGTAGTTAACTT
CGTATGTATGCATAGGTGTTTATGACTTACAGTTTTATTACTAATTACAGGGCTGTGATGCTTCCGTCTTGTTGGACGATTCTGCAGCTATAGTTAGTGAAAAGAATTCAGTACCAAACA
GGAATTCCCTCAGAGGATTTGAAGTGATTGACGAGATCAAGGCTAAGCTGGAAGAAGCATGTCCTCAGACTGTTTCTTGTGCAGACATTGTCGCCCTAGCTGCTCGCGGCTCCGTTGTAC
TA
GTAAGCAAAATTCTAACAAAACTGATGTTAGGTAGATCATATAAAAGATTCAGGACAGAGAACTTTGTTAATAACTATTACTGGGTATGCTCAAACAGAGCGGAGGACCGTCTTGGGA
GCTCCCCCTTGGAAGGAGGGACTCGAGAACAGCAAGCTTAAGTGGCTCAAACAGTAACATTCCCCCGCCAAACTCTACCGTCCAAAACCTTATAGCATCCTTCAAGCGTCAAGGCCTAAA
TGAAGTAGACCTTGTCTCTCTTTCAG
GTAATTAATTACTGTATAGCACTGCATTTAATGAACTGAACCTGATTCTCTAAACTAAGTATTTTGTTTGATGTCATGTTGCAGGAGGGCATAC
AATTGGGGTGGCAAGGTGTGTGACCTTCAAGCAAAGGCTATATAATCAAAATGGAAACAACCAACCGGATGAGACTTTAGAGAGGACATATTACTTCGGTTTAAAATCAGTCTGCCCAAG
AACAGGCGGCGACAATAACATCTCCCCGCTAGACTTTGCCTCACCAGCAAAATTTGATAACACCTACTTCAAGCTTGTTCTGTTGGGCAAAGGGCTTCTCACATCTGATGAAGTGCTTTT
GACAGGCGATGTGGGGAACATCGTGCAACTAGTTAAGTCCTACGCTGAGGATGATGAGCTCTTCTTTAAACAGTTTGCTCAGTCAATGGTTAAGATGGGGAACATTAGCCCTCTCACTGG
CTTTAATGGTGAAGTTAGGAAGAATTGTCGCCTAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTTCAAATTGGCTATCACTCTACTGCTACTAGCTTTGATCTCAGCCAGGATCTCACTAGCTCACCCTGGAATTGGCATTGGCTGGGGTGGTAATGGCCAGTATGGAGGCAGC
TTCTATGGCCTCTTTCCACAATTTTATCAGTTTTCATGCCCACAAGTTGATAACATTGTCATGTCAGTGCTCCAGAAGGCCATTGCAAGACAGCCCAGAATAGCTGCCTCTTTGCTTAGG
CTTCATTTCCATGATTGCTTTGTTCAG
GGCTGTGATGCTTCCGTCTTGTTGGACGATTCTGCAGCTATAGTTAGTGAAAAGAATTCAGTACCAAACAGGAATTCCCTCAGAGGATTTGAA
GTGATTGACGAGATCAAGGCTAAGCTGGAAGAAGCATGTCCTCAGACTGTTTCTTGTGCAGACATTGTCGCCCTAGCTGCTCGCGGCTCCGTTGTACTA
AGCGGAGGACCGTCTTGGGAG
CTCCCCCTTGGAAGGAGGGACTCGAGAACAGCAAGCTTAAGTGGCTCAAACAGTAACATTCCCCCGCCAAACTCTACCGTCCAAAACCTTATAGCATCCTTCAAGCGTCAAGGCCTAAAT
GAAGTAGACCTTGTCTCTCTTTCAG
GAGGGCATACAATTGGGGTGGCAAGGTGTGTGACCTTCAAGCAAAGGCTATATAATCAAAATGGAAACAACCAACCGGATGAGACTTTAGAGAGG
ACATATTACTTCGGTTTAAAATCAGTCTGCCCAAGAACAGGCGGCGACAATAACATCTCCCCGCTAGACTTTGCCTCACCAGCAAAATTTGATAACACCTACTTCAAGCTTGTTCTGTTG
GGCAAAGGGCTTCTCACATCTGATGAAGTGCTTTTGACAGGCGATGTGGGGAACATCGTGCAACTAGTTAAGTCCTACGCTGAGGATGATGAGCTCTTCTTTAAACAGTTTGCTCAGTCA
ATGGTTAAGATGGGGAACATTAGCCCTCTCACTGGCTTTAATGGTGAAGTTAGGAAGAATTGTCGCCTAGTTAATTAA

Retrieve as FASTA