Entry information : CclPrx25 (clementine0.9_015054m)
Entry ID 8689
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CclPrx25 (clementine0.9_015054m)
Name (synonym) CclPrx25 (clementine0.9_015054m)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx25
start..stop
S start..stop
CsPrx49 705 0 1..338 1..338
VvPrx27 464 1e-165 10..338 14..332
RcPrx04 461 1e-164 1..338 1..329
MePrx89 459 5e-164 1..338 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3541516..3541743 228 N° 2 3540553..3541341 789  
complement(join(3540553..3541341,3541516..3541743))


exon

Literature and cross-references CclPrx25 (clementine0.9_015054m)
DNA ref. Phytozome 12:   scaffold_3 (3541743..3540553)
Protein sequence: CclPrx25 (clementine0.9_015054m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (311)
PWM (Da):   %s   36721.23 (33829.9)  
PI (pH):   %s   8.3 (8.42) Peptide Signal:   %s   cut: 28 range:28-338
Sequence 379
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSYAKMDSCMIMCILILVSTMPLGTSANAKLKVGFYKSTCPSAESIVRKAVNKAVSCNPGIAAGLIRMHFHDCFVRGCDASVLLETIPGNPPSERDDHVNNPSLRGFEVIDEAKAQIEAVCPNTVSCADILTFAARDSTSKVGGINYAVPAGRRDGRVSLSNEIAENLPSPTFNAEQLAARFARKGISVDEMVTLVGAHSIGVSHCSSFSKRLYAFNTTHPQDPSMDHRFANFLKNKCPPPPPTDGLGCTRDPTVTQEFVTPNRLDNKYYRELRNHRGLLTSDQTLMDSRLTSKMVLDNERNGAMWGTKFAKAMVHVGSLDVLTGSQGEIRKHCSFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTACGCTAAGATGGACTCCTGCATGATCATGTGCATCCTCATACTGGTCTCCACCATGCCTTTGGGAACATCAGCAAATGCAAAGCTCAAAGTAGGCTTCTATAAATCAACTTGT
CCATCGGCAGAGTCAATTGTGAGAAAAGCCGTAAACAAAGCTGTGTCTTGCAATCCTGGCATAGCCGCAGGCCTCATCAGGATGCATTTCCACGACTGCTTTGTCAGA
GTACGTAAATGC
ATGCTCTTATTCATCCTCATCGTAATTAATTGATTATCAAGTATGTTTGTGCTTGGCTTGATTCTTTTCGCTCAATTAATTAAAATGATATGAAAGTAGTTGTCGTTCGTAATTAACGTA
TCTGATATATATATATATCATTTTTGTCTGCTGCATGCACAGGGCTGTGATGCTTCCGTGCTGCTAGAAACCATACCAGGAAACCCACCTTCAGAGAGAGACGATCATGTCAACAACCCA
AGCTTACGAGGCTTCGAGGTGATCGACGAGGCCAAAGCACAAATTGAAGCTGTGTGCCCAAACACCGTGTCATGTGCAGATATTCTAACTTTCGCTGCTCGCGACAGTACTTCCAAGGTC
GGTGGCATCAACTACGCCGTGCCAGCTGGACGCCGCGATGGACGAGTCTCTCTCAGCAATGAAATTGCAGAAAATCTCCCTTCTCCTACCTTCAACGCGGAACAACTAGCTGCAAGGTTT
GCTCGTAAAGGAATTTCCGTAGACGAGATGGTGACACTCGTAGGAGCTCACTCCATTGGTGTCTCTCATTGCTCTTCATTCTCCAAGCGTCTTTACGCTTTCAATACAACTCACCCACAA
GACCCTTCAATGGATCATAGATTCGCTAATTTCTTGAAAAATAAGTGCCCGCCGCCACCACCAACAGACGGCTTAGGCTGTACTAGGGACCCAACAGTGACACAAGAATTTGTGACGCCT
AATCGTTTGGACAACAAGTACTACCGGGAACTGAGGAATCACCGAGGGTTGTTGACTTCGGATCAGACTTTGATGGACAGCCGGTTAACATCAAAGATGGTATTGGACAATGAAAGGAAT
GGAGCAATGTGGGGAACAAAATTTGCTAAAGCAATGGTGCATGTGGGATCCCTTGATGTGCTCACTGGCTCACAGGGTGAGATCAGGAAGCATTGCAGTTTCGTGAATTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTACGCTAAGATGGACTCCTGCATGATCATGTGCATCCTCATACTGGTCTCCACCATGCCTTTGGGAACATCAGCAAATGCAAAGCTCAAAGTAGGCTTCTATAAATCAACTTGT
CCATCGGCAGAGTCAATTGTGAGAAAAGCCGTAAACAAAGCTGTGTCTTGCAATCCTGGCATAGCCGCAGGCCTCATCAGGATGCATTTCCACGACTGCTTTGTCAGA
GGCTGTGATGCT
TCCGTGCTGCTAGAAACCATACCAGGAAACCCACCTTCAGAGAGAGACGATCATGTCAACAACCCAAGCTTACGAGGCTTCGAGGTGATCGACGAGGCCAAAGCACAAATTGAAGCTGTG
TGCCCAAACACCGTGTCATGTGCAGATATTCTAACTTTCGCTGCTCGCGACAGTACTTCCAAGGTCGGTGGCATCAACTACGCCGTGCCAGCTGGACGCCGCGATGGACGAGTCTCTCTC
AGCAATGAAATTGCAGAAAATCTCCCTTCTCCTACCTTCAACGCGGAACAACTAGCTGCAAGGTTTGCTCGTAAAGGAATTTCCGTAGACGAGATGGTGACACTCGTAGGAGCTCACTCC
ATTGGTGTCTCTCATTGCTCTTCATTCTCCAAGCGTCTTTACGCTTTCAATACAACTCACCCACAAGACCCTTCAATGGATCATAGATTCGCTAATTTCTTGAAAAATAAGTGCCCGCCG
CCACCACCAACAGACGGCTTAGGCTGTACTAGGGACCCAACAGTGACACAAGAATTTGTGACGCCTAATCGTTTGGACAACAAGTACTACCGGGAACTGAGGAATCACCGAGGGTTGTTG
ACTTCGGATCAGACTTTGATGGACAGCCGGTTAACATCAAAGATGGTATTGGACAATGAAAGGAATGGAGCAATGTGGGGAACAAAATTTGCTAAAGCAATGGTGCATGTGGGATCCCTT
GATGTGCTCACTGGCTCACAGGGTGAGATCAGGAAGCATTGCAGTTTCGTGAATTG

Retrieve as FASTA