Entry information : SbPrx76 (Sobic.004G106000.1 [2.1] / SB04G008640 [1.4])
Entry ID 869
Creation 2010-01-07 (Christophe Dunand)
Last sequence changes 2010-01-07 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx76 (Sobic.004G106000.1 [2.1] / SB04G008640 [1.4])
Name (synonym) SbPrx76 (Sobic.004G106000.1 [2.1] / SB04G008640 [1.4])
Class Class III peroxidase    [Orthogroup: Prx243]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx76
start..stop
S start..stop
ZmPrx122 427 7e-152 3..321 2..316
SiPrx79 305 2e-103 6..319 2..316
PabPrx236 290 7e-98 17..320 5..317
BdiPrx131 288 4e-97 14..320 7..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10092237..10092464 228 N° 2 10093632..10093847 216 N° 3 10093977..10094498 522  
join(10092237..10092464,10093632..10093847,10093977..10094498)


exon

Literature and cross-references SbPrx76 (Sobic.004G106000.1 [2.1] / SB04G008640 [1.4])
Literature Cordonnier-Pratt, M.-M. et al., unpublished.
DNA ref. Phytozome 12:   chromosome_4 (10092237..10094498)
Protein sequence: SbPrx76 (Sobic.004G106000.1 [2.1] / SB04G008640 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (292)
PWM (Da):   %s   34855.57 (31919.2) Transmb domain:   %s   i12-29o
PI (pH):   %s   5.21 (5.05) Peptide Signal:   %s   cut: 30 range:30-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSSTTTTGGHYMFLVALSLLSFAAYGQLSEQFYAAKCPSLDQIIKAEVDRTLSVDRRMGASLLRLFFHDCFVQGCDASVLLDDDAAKSITSEKTAGPNDKSLRGFDVIDRIKDQVEAACGVPGARVGVVSCADILALVTKQAVIYLAGQPGWAGWSLLLGRRDSTTANKDEANTVLPSPNSELPTLIEAFKNKNFTGRELVALSGAHTIGVAQCGNVDETQRQKCIDANNNNTFPLDDETPVDFDKGYYDNLLRDKGLLHSDRVLVDSNDLKLLVLQYARRKDLFFKDFANAMEKMSLMSVLTGTNGEIRLNCSRVNY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCATCATCCACTACCACCACCGGCGGCCATTATATGTTCCTTGTCGCGCTCTCTCTTCTCTCCTTCGCCGCCTACGGGCAGCTCTCGGAACAATTCTACGCCGCAAAGTGC
CCGTCGTTGGATCAAATCATCAAAGCAGAGGTGGATCGTACCTTGTCCGTGGATCGACGGATGGGCGCCTCCCTCCTCAGGCTCTTCTTCCATGACTGCTTTGTTCAG
GTATTCTTTTAT
CTTATTATATTACTACTCCTTTAGCCTAATACCTAGACTCTTTTGTAATATATTTAAAAATAAAAATTTTGAATAAAAGATAGAATAAGCACTATATATATTTTCAATATAACACATGAA
AAATTATAGCAATTAATAAGATTAAAAGTTGAAATATAAAGTATAGATTCATGGTGTCAAAGAAAATAGATAAGCTAGCTTATGTTTCAACTGGCTATATATCATGCTAGAGAAAAGTTA
AATCCTAGATATTCTAACTAGAGATTCCAATAACAATAATGAAACCTCCACATTAACCCTCATGATACATGTTAGAAGAAACAAATCCTTGAAATTCTCACAAAATTATATTTACTCTTG
ACCTTCGAATTAGTGTACTCTAATAATTAATCATCATTGCGCTCGTGTACGTGAGTGCCTGTGTTTATAACTGGGTCTCGAAAAAAAAGGTCAAGCAATTATCCACCGATCTTAAGTGAC
ATGGTGCATGTATAACTGTTACGCTAGCTATTGTAGTACTTAAGAGTGCAACCCTAGCAGCCTAAAATCTTTGATTTTAATGAGAGACAACATGAGAGTTTATAAAAGACACAGTATGCA
TAAGAGTTTGTCTAATTAACCTGAGGGGTAAACAAAATATGTTGCCACTAATAAAACTGAAATTTGTAAAAAAAACAAAATTTATTATAGATTCATGGAATCATAAGAGACATGGGCTGC
AACATAAGCCATCATATATAGTTAGGCTAACGTCTATTATAACTAAAAAATGTATATTCTCAACAAAGAGCTATCTTGCAAAGGAAAAAAAATTGATACAAACGAAAAAGAACATATATA
TTGAGATTATTATCTACTATCTACTGATCTGTATATACAGTTTCATGCAATCTACCGATGATCTACCTATACATATATACGGCACTACAAAAATGGTGGAGTTCTCCTAGTGTTTTTAGT
TAGTAATAAAACACTACCACTAGTCAAAACACTAGGGAATCCTCACTAGGAGGTATTTACTAGGGAAAGTTTATACTAATTTTTGAATGCTAAAACACTAGGAAAACCCCACACTACTAG
GAGAAATTGAAAAATCTGGTTGTGCGGTATATCATGCACGAGCATGACGATGCATGGATGCCATTGGTCGTGCAGGGCTGCGACGCCTCGGTTCTTCTGGACGACGACGCGGCAAAGTCG
ATCACAAGCGAGAAGACGGCCGGCCCGAACGACAAGTCCCTACGCGGCTTCGACGTGATCGACCGGATCAAGGATCAAGTCGAGGCAGCCTGCGGCGTCCCCGGCGCCCGCGTCGGCGTT
GTCTCCTGCGCAGACATCCTCGCCCTCGTTACCAAGCAAGCCGTCATCTAC
GTACGTAATTAATTTATGATTGTACACTAATTACAAAATAAACAAAAAAAATCCTATGTTAAATTTTAG
CACCTCTAACCAAACACGCCCTATAAAACGGCTTTTGATGCATGCGCTATATATATGCAGCTCGCTGGACAACCAGGATGGGCTGGATGGTCGTTGTTACTCGGCCGGCGTGACTCCACG
ACGGCAAACAAGGATGAAGCAAACACCGTCCTCCCGTCGCCGAACTCAGAGCTCCCGACGCTCATCGAGGCATTCAAGAACAAGAATTTCACCGGCAGAGAGCTGGTAGCGCTGTCCGGC
GCGCACACCATCGGCGTGGCGCAGTGCGGCAACGTCGACGAAACCCAGCGGCAGAAATGCATCGACGCCAATAACAACAACACCTTCCCGCTCGACGACGAGACGCCTGTGGACTTCGAC
AAGGGCTACTACGATAACCTGCTGCGGGACAAAGGCTTGCTGCACTCGGACCGCGTGCTCGTGGACAGCAACGATCTCAAGCTCCTCGTGCTGCAGTACGCGAGGAGAAAGGACCTTTTC
TTCAAGGACTTCGCCAACGCGATGGAAAAGATGTCGTTGATGAGCGTGCTCACCGGAACTAATGGCGAGATCAGGCTCAACTGCAGTAGGGTTAACTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCATCATCCACTACCACCACCGGCGGCCATTATATGTTCCTTGTCGCGCTCTCTCTTCTCTCCTTCGCCGCCTACGGGCAGCTCTCGGAACAATTCTACGCCGCAAAGTGC
CCGTCGTTGGATCAAATCATCAAAGCAGAGGTGGATCGTACCTTGTCCGTGGATCGACGGATGGGCGCCTCCCTCCTCAGGCTCTTCTTCCATGACTGCTTTGTTCAG
GGCTGCGACGCC
TCGGTTCTTCTGGACGACGACGCGGCAAAGTCGATCACAAGCGAGAAGACGGCCGGCCCGAACGACAAGTCCCTACGCGGCTTCGACGTGATCGACCGGATCAAGGATCAAGTCGAGGCA
GCCTGCGGCGTCCCCGGCGCCCGCGTCGGCGTTGTCTCCTGCGCAGACATCCTCGCCCTCGTTACCAAGCAAGCCGTCATCTAC
CTCGCTGGACAACCAGGATGGGCTGGATGGTCGTTG
TTACTCGGCCGGCGTGACTCCACGACGGCAAACAAGGATGAAGCAAACACCGTCCTCCCGTCGCCGAACTCAGAGCTCCCGACGCTCATCGAGGCATTCAAGAACAAGAATTTCACCGGC
AGAGAGCTGGTAGCGCTGTCCGGCGCGCACACCATCGGCGTGGCGCAGTGCGGCAACGTCGACGAAACCCAGCGGCAGAAATGCATCGACGCCAATAACAACAACACCTTCCCGCTCGAC
GACGAGACGCCTGTGGACTTCGACAAGGGCTACTACGATAACCTGCTGCGGGACAAAGGCTTGCTGCACTCGGACCGCGTGCTCGTGGACAGCAACGATCTCAAGCTCCTCGTGCTGCAG
TACGCGAGGAGAAAGGACCTTTTCTTCAAGGACTTCGCCAACGCGATGGAAAAGATGTCGTTGATGAGCGTGCTCACCGGAACTAATGGCGAGATCAGGCTCAACTGCAGTAGGGTTAAC
TATTAA

Retrieve as FASTA