Entry information : CclPrx31 ( clementine0.9_015354m)
Entry ID 8691
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-22 (Christophe Dunand)
Peroxidase information: CclPrx31 ( clementine0.9_015354m)
Name (synonym) CclPrx31 ( clementine0.9_015354m)
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx31
start..stop
S start..stop
CsPrx50 670 0 1..332 1..332
CclPrx111 567 0 25..332 25..331
CsPrx51 506 0 71..332 130..390
GrPrx41 491 1e-176 1..328 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1163199..1163417 219 N° 2 1162422..1162604 183 N° 3 1161760..1161922 163 N° 4 1160875..1161308 434
complement(join(1160875..1161308,1161760..1161922,1162422..1162604,1163199..1163 417))


exon

Literature and cross-references CclPrx31 ( clementine0.9_015354m)
DNA ref. Phytozome 12:   scaffold_31 (1163417..1160875)
Protein sequence: CclPrx31 ( clementine0.9_015354m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (306)
PWM (Da):   %s   35499.88 (32552.3)  
PI (pH):   %s   8.15 (7.31) Peptide Signal:   %s   cut: 27 range:27-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNRSFTKFGGHFLFAIFFVLCLGVKSQLSTNFYSKTCPNVLQIVRREVQKAIKVEMRMAASLIRLHFHDCFVNGCDASVLLDGSDSEKFAAPNRNSARGFEVIDAIKTAVEGQCSGVVSCADILAIAARDSVLLSGGPTWKVLLGRRDGLVANQTGANALPSPFEGLNILTAKFAAVGLNITDLVSLSGGAHTIGLAKCAFFSNRLSNFSGTGAPDATMDTSLVSELRSLCANGDGNNTAPLDRNSIDLFDNHYFQNLINNKGLLNSDQILYSSDEAKSTTKSLVESYSSNSNLFFANFVNSMIKMGNVSPLTGTNGEIRKNCRAVNSLTEI

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATAGGTCATTTACGAAGTTCGGTGGTCATTTTCTCTTCGCGATTTTCTTTGTGTTGTGTCTAGGTGTTAAGTCTCAACTAAGTACTAATTTTTACTCGAAAACGTGCCCAAATGTT
CTTCAAATTGTGAGGAGAGAAGTTCAGAAAGCAATCAAGGTTGAAATGAGAATGGCAGCCTCTTTGATCCGACTTCATTTCCATGATTGCTTCGTTAAT
GTGAGTTTAGGCTTTGAAATG
CTTATTGTAGTATCATTAGTAACGTTTTTCTTAAATCTTTAGATTGATGTGCCAAGCATATATCTTAAGTGTTCAAAAGTTACTGTAGATTGTTGGGCACCTGCCTTTAAGCTTGTACTA
TTATTAAGTCAAAGTGGTAGTTCAGTATGATCCACAGCATATATATTTGACCTAAATGTCTCCTGCTCGAATATTTTCGAATACAAATTAAATATAATTTGCACATAATTGTATGAGTTG
TTTGGATTTAATTTACGTGACATATCTAAAGAAGACTTGTAAAAAAGAATGAATGATATACCAAACTTAAAAATTATTTTTTAGTTTAATTCATGAGTCAAGACTAACATATTATAGTTT
CATTTTTATTCTTTTTTGGATCAAGTGCTTATATATTCTCAGTTCAAGCAGCTTTAATCTTGCATTGCACGGCTAAAAGGATAGTATACTGTACACTAGTTTATGAATAAATAAAATTTA
TGTATCTTTAATTTTACTATCATTTTTTTCCCTAAATTATTCATCATTTGGTAATTATAATTATTATAAACTTGATCTCCTTCTTTGTTATAGGGTTGTGATGCATCAGTGTTATTGGAT
GGAAGTGACAGTGAGAAGTTTGCCGCGCCTAACCGGAACTCAGCACGAGGATTTGAAGTTATTGACGCAATAAAAACTGCTGTGGAAGGTCAATGCAGTGGAGTTGTATCATGCGCTGAT
ATTTTAGCCATAGCTGCAAGAGATTCAGTGCTCTTG
GTAAGTTGGTTGATTAATTATTCTTCTCATATAGATTCCATGGGACTAAAAGAAATAGAGACATGAGAAACTTGAGACCTTNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTGTGTCTTAAAAGATAGATCTGAAC
TAAATTATCAAGTAGGGACTAAGTCATCTTAGTTCACAGGATTCTACCAATTAATAGATAAAGAATTTTCTTTTTTCATATTCTAATGATATGAGAAAATTAAAATTTTCTCTTTATATT
TGAACTTTATGAGGTTAACTTTTACTTATACAAATACTATGACAATATTTTGCAGAGTGGAGGACCTACATGGAAAGTTCTGCTGGGAAGAAGAGATGGACTGGTGGCAAACCAGACAGG
TGCCAATGCTCTTCCTTCACCATTTGAGGGGCTAAACATTCTCACTGCCAAGTTTGCAGCCGTGGGTCTAAATATTACAGACTTAGTGTCCTTGTCAG
GTAATTTATTTGACCTCTCTAT
CACCATATATTTGTATCAAATCATCATAACTAATTAGCCTTCATTCGGGGTCACTTTAAATTGTAAAGTAATGACATTCTATATAAATTTGGCTCCTCTACTAGTTTAACTTATTTAAAA
GATCTCGTGAGACATGTGNNNNNNNNNNNNNNNNNNNNNNGTGTAGATTGAGTCAACTCATCGTTCATACCTCAAATTGTGCTCGTGTCAAACTCAATTTTTTAAAATTCGGCCATATAT
TACCCGTTTTTGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATTCATCTATCCGAAATTTTCTCAATGTTTGAAACATATCCCAAAAGTTTGCATT
AGGAATCTCAGGACCCCATTTTGAACTCCCATAATGTGCGAGCTCGGTAATTTTAATGTTTATGTGCAGGTGGTGCTCATACAATTGGACTCGCAAAATGTGCCTTCTTCAGCAATAGAC
TATCCAACTTCTCAGGGACAGGTGCTCCAGACGCTACAATGGACACAAGCTTGGTGTCCGAATTGCGGAGCCTATGTGCTAACGGTGACGGAAACAATACGGCGCCGCTTGATCGGAACT
CGATTGATCTATTTGACAACCATTACTTCCAGAACTTGATCAACAATAAGGGCCTTCTTAATTCTGATCAAATTCTATACTCTAGTGATGAGGCCAAATCAACTACTAAGAGTCTTGTTG
AAAGCTATAGCAGCAACTCAAATCTTTTCTTTGCTAATTTTGTTAATTCTATGATCAAAATGGGGAATGTAAGTCCACTCACCGGGACTAATGGTGAGATTAGGAAGAACTGCAGGGCAG
TTAATTCCTTAACTGAGATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATAGGTCATTTACGAAGTTCGGTGGTCATTTTCTCTTCGCGATTTTCTTTGTGTTGTGTCTAGGTGTTAAGTCTCAACTAAGTACTAATTTTTACTCGAAAACGTGCCCAAATGTT
CTTCAAATTGTGAGGAGAGAAGTTCAGAAAGCAATCAAGGTTGAAATGAGAATGGCAGCCTCTTTGATCCGACTTCATTTCCATGATTGCTTCGTTAAT
GGTTGTGATGCATCAGTGTTA
TTGGATGGAAGTGACAGTGAGAAGTTTGCCGCGCCTAACCGGAACTCAGCACGAGGATTTGAAGTTATTGACGCAATAAAAACTGCTGTGGAAGGTCAATGCAGTGGAGTTGTATCATGC
GCTGATATTTTAGCCATAGCTGCAAGAGATTCAGTGCTCTTG
AGTGGAGGACCTACATGGAAAGTTCTGCTGGGAAGAAGAGATGGACTGGTGGCAAACCAGACAGGTGCCAATGCTCTT
CCTTCACCATTTGAGGGGCTAAACATTCTCACTGCCAAGTTTGCAGCCGTGGGTCTAAATATTACAGACTTAGTGTCCTTGTCAG
GTGGTGCTCATACAATTGGACTCGCAAAATGTGCC
TTCTTCAGCAATAGACTATCCAACTTCTCAGGGACAGGTGCTCCAGACGCTACAATGGACACAAGCTTGGTGTCCGAATTGCGGAGCCTATGTGCTAACGGTGACGGAAACAATACGGCG
CCGCTTGATCGGAACTCGATTGATCTATTTGACAACCATTACTTCCAGAACTTGATCAACAATAAGGGCCTTCTTAATTCTGATCAAATTCTATACTCTAGTGATGAGGCCAAATCAACT
ACTAAGAGTCTTGTTGAAAGCTATAGCAGCAACTCAAATCTTTTCTTTGCTAATTTTGTTAATTCTATGATCAAAATGGGGAATGTAAGTCCACTCACCGGGACTAATGGTGAGATTAGG
AAGAACTGCAGGGCAGTTAATTCCTTAACTGAGATATGA

Retrieve as FASTA