Entry information : CclPrx34 (clementine0.9_015468m)
Entry ID 8694
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx34 (clementine0.9_015468m)
Name (synonym) CclPrx34 (clementine0.9_015468m)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx34
start..stop
S start..stop
CsPrx42 679 0 1..330 1..330
PtPrx31 527 0 16..329 12..330
NnPrx46 499 1e-179 27..330 37..339
VvPrx09 474 9e-170 27..329 34..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4754171..4754386 216 N° 2 4754528..4754722 195 N° 3 4755340..4755921 582  
join(4754171..4754386,4754528..4754722,4755340..4755921)


exon

Literature and cross-references CclPrx34 (clementine0.9_015468m)
DNA ref. Phytozome 12:   scaffold_10 (4754171..4755921)
Protein sequence: CclPrx34 (clementine0.9_015468m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (305)
PWM (Da):   %s   36370.86 (33687.4) Transmb domain:   %s   i2-21o
PI (pH):   %s   9.63 (9.74) Peptide Signal:   %s   cut: 26 range:26-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFITSLISLLAALSFFLVFIPCNARLKHDFYKKTCPNVEKIIYNVASQKLLEAPVTAAGALRIFFHDCFVEGCDASVLIASSKTNKAERDSEINLSLPGDGYEVFFRAKRALELQCPGIVSCADIMAIATRDLVHLAGGPRWEVAKGRRDGLISKASRVEGNLPHVNQTISQTISLFKSKGLSTLDMVALSGGHTIGFSHCKEFMPRIYSYNKTHDIDPTMNQDFARSLRGSCPKSKKLDPTVVALNDVSTPFVFDNFYYKNIKKGLGLLATDQMLLLDSRTRAYVKRMADAKTAFFKHFVVAMIKLSNIGVKTGKDGEIRRDCGSFNG*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTATAACTTCATTAATCTCTCTCCTTGCTGCTCTCAGCTTCTTCTTAGTTTTTATTCCTTGCAATGCAAGACTTAAACATGATTTCTACAAAAAGACTTGCCCAAATGTGGAG
AAAATCATCTACAATGTGGCCTCGCAGAAGCTGCTTGAAGCACCAGTCACCGCCGCCGGGGCTCTTCGCATTTTCTTCCACGACTGCTTCGTTGAG
GTTTGATNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNACTAGAATGCCCCATTACCTTCTTAGCCATTACTTTAATTAATTAAAGATGGGGAATTTTGTAATATGAATTGATATTGTAATTTGAAGGGT
TGTGATGCGTCGGTCTTGATTGCGTCAAGTAAAACCAACAAGGCCGAAAGGGATTCAGAAATCAACTTGTCACTTCCCGGCGATGGTTATGAAGTGTTCTTTCGAGCAAAGAGAGCGTTG
GAGTTGCAGTGCCCTGGCATTGTCTCTTGTGCCGATATTATGGCAATTGCTACAAGAGACTTGGTTCATTTG
GTAACTTCCTCTCATTCTCATCATTCACTTTCATTTTCACCGTTATTA
TTGCTCCCCCTTTCTGACTGTTACAACACTTTTTTAAAGTAGTGTCGCATAATGAAAGCTAATAACTGAGTGAGCATAAAAAACAAAGGGAGAATATTATTTTGGTCTCTTTTATAAATT
ATATTTACTACTTAGTTATTGGATAAATTTTTAATCTCCTATTTCATCTCTGGTGCTTACTGGTTTTGATTTGGAAAGTTTTAGCTAATCATTTTTTACATTATCACATTTACTATATGA
ATATTATTCTAAGAACAATAATAGATACAGCTTGAATGAGATTCCTTTAGGGGAAATGGATTCAACCCAATCAACCCACATGGTGTGGAGAGATATTTAGTCTTTATTAAAAAAATTAAT
GGCGGACTTAAGTGGTTAAAATAATTTCCAAAGGAGATTAAGGTGTTATTTTCTTAATAAATAAATATGTCGTAATAATTATCTAACAATTGACAGAGTGTATACATTGGCAGCGCTCAA
ATGCTTTCCCCTAAAAATTTTACGAAGTAAATCATTAGCGTGTCCATTTATTTTTTACCAAGAAAAATTAACATGACTTGCTTCAAAAGGCGGGAGGCCCAAGATGGGAAGTAGCAAAAG
GAAGAAGAGATGGCCTTATTTCCAAGGCTTCAAGAGTAGAGGGCAACCTCCCACACGTGAACCAAACAATATCTCAAACAATCTCACTCTTCAAATCGAAAGGCTTATCAACTCTGGACA
TGGTAGCCCTATCTGGAGGCCACACAATTGGCTTCTCGCATTGCAAAGAGTTCATGCCAAGAATCTATAGCTACAACAAAACACATGACATTGATCCAACCATGAACCAAGACTTTGCTC
GCAGCCTTCGGGGTTCATGTCCTAAGTCTAAGAAACTTGATCCAACTGTTGTTGCACTCAATGATGTCAGTACACCTTTCGTATTTGATAATTTTTACTACAAAAATATTAAGAAGGGAC
TTGGGTTGCTGGCTACTGATCAGATGTTGCTTTTGGATTCAAGGACTCGAGCGTATGTGAAAAGAATGGCTGATGCTAAAACTGCATTTTTTAAGCACTTTGTTGTTGCCATGATCAAGT
TGAGTAACATTGGGGTTAAGACTGGCAAGGATGGTGAGATCAGGAGAGATTGTGGTTCCTTCAACGGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTATAACTTCATTAATCTCTCTCCTTGCTGCTCTCAGCTTCTTCTTAGTTTTTATTCCTTGCAATGCAAGACTTAAACATGATTTCTACAAAAAGACTTGCCCAAATGTGGAG
AAAATCATCTACAATGTGGCCTCGCAGAAGCTGCTTGAAGCACCAGTCACCGCCGCCGGGGCTCTTCGCATTTTCTTCCACGACTGCTTCGTTGAG
GGTTGTGATGCGTCGGTCTTGATT
GCGTCAAGTAAAACCAACAAGGCCGAAAGGGATTCAGAAATCAACTTGTCACTTCCCGGCGATGGTTATGAAGTGTTCTTTCGAGCAAAGAGAGCGTTGGAGTTGCAGTGCCCTGGCATT
GTCTCTTGTGCCGATATTATGGCAATTGCTACAAGAGACTTGGTTCATTTG
GCGGGAGGCCCAAGATGGGAAGTAGCAAAAGGAAGAAGAGATGGCCTTATTTCCAAGGCTTCAAGAGTA
GAGGGCAACCTCCCACACGTGAACCAAACAATATCTCAAACAATCTCACTCTTCAAATCGAAAGGCTTATCAACTCTGGACATGGTAGCCCTATCTGGAGGCCACACAATTGGCTTCTCG
CATTGCAAAGAGTTCATGCCAAGAATCTATAGCTACAACAAAACACATGACATTGATCCAACCATGAACCAAGACTTTGCTCGCAGCCTTCGGGGTTCATGTCCTAAGTCTAAGAAACTT
GATCCAACTGTTGTTGCACTCAATGATGTCAGTACACCTTTCGTATTTGATAATTTTTACTACAAAAATATTAAGAAGGGACTTGGGTTGCTGGCTACTGATCAGATGTTGCTTTTGGAT
TCAAGGACTCGAGCGTATGTGAAAAGAATGGCTGATGCTAAAACTGCATTTTTTAAGCACTTTGTTGTTGCCATGATCAAGTTGAGTAACATTGGGGTTAAGACTGGCAAGGATGGTGAG
ATCAGGAGAGATTGTGGTTCCTTCAACGGTTAA

Retrieve as FASTA