Entry information : CclPrx39 (clementine0.9_015683m / Ciclev10026073m)
Entry ID 8696
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2014-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: CclPrx39 (clementine0.9_015683m / Ciclev10026073m)
Name (synonym) CclPrx39 (clementine0.9_015683m / Ciclev10026073m)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx39
start..stop
S start..stop
CsPrx06 659 0 1..326 1..326
RcPrx30 553 0 1..326 1..329
TcPrx17 548 0 12..322 13..323
CpapPrx43 547 0 15..326 15..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3214455..3214649 195 N° 2 3214167..3214358 192 N° 3 3212877..3213470 594  
complement(join(3212877..3213470,3214167..3214358,3214455..3214649))


exon

Literature and cross-references CclPrx39 (clementine0.9_015683m / Ciclev10026073m)
DNA ref. Phytozome 12:   scaffold_23 (3214649..3212877)
Protein sequence: CclPrx39 (clementine0.9_015683m / Ciclev10026073m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (309)
PWM (Da):   %s   35949.01 (34049.0)  
PI (pH):   %s   4.97 (4.97) Peptide Signal:   %s   cut: 18 range:18-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSILFFLLLITMATADPLRPRYYSETCPEAESIVGDVIMKAMIREPRSGASVMRFQFHDCFVNGCDASMLLDDTPTMLGEKLSLSNINSLRSYEVIDEVKEALEKACPGTVSCADIIIMASRDAVALSGGPSWEVKLGRKDSLTASQKDADDIMPSPRANASFLVDLFAKFDLSIKDLVALSGSHSIGQGRCFSIMFRLYNQSGSGKPDPAIEPKFREKLNRLCPIGGDENVTVDLDATPQAFDNQYFKDLVAGRGFLNSDETLYTYPWTRPYVKLYGKDQDKFFKAFVEGMIKLGDLQSGKPGEIRTNCRVVNSRAVDVLLES*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST. One short alternative transcript from Phytozome.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCCCCCACG ACCCGGAGCC GATGATGCGG GGATATTGGA CCACTTCATT GACAAAACTC TGAACTCTGA TGATTTTTTT TGGGTCATCC TGCCACCAAT TTTACCTTAT TGCCCACGAT  AATTATTGAC AATAATCTAA AATTATTATT ACTTGAAAAA ATGGTAAAAA TCTCTCGTGG CTGGTCAAAA GTGTTTTGAT TCACTGGATT TCATGAAGAG CCGAGCGGTC GCATACTTTA  GGACGATCGT TAAGATGTAT ACGAATATTT TTTATCGTCT GATTATTTTA ATTTTGGATT TAAGATTTGT TTTTTTTAAG CACCACCGGT TTTTATTATA TTTAATTTTT CATTTTAAAG  CAATTGATTA TTCGATCCGA GTCAAACTAC TGGCTCAATT TATCCGTTTT TGCATTTGAT AGGTACAATG AATAGAGCAA TTATTATCAG TGATAAGACA TTTTTAATGT TAGATTGACG  TTACTTTTAC CCATTCACTG CAAAATCGAT AATAATTGAC CATTGCTTGG GAATTCAGCA ACGTTTTTTG TGGGACTTTC TCGGGGCTTG TGATGAATTG AAATCAAATT CAGAGACTAT  TGAATTGAAG GCTAAAAACA TCATCCAATT CGATAGCGGC GAGGCATTAG AGAGTGACAC AGCAACCTAT CTATGTTGGA TAATTGTCCG TGATCAAATA CCTAGAGAAA TGAATTTAGT  ATAATCTTTT GATGTGATCA CAGTACGTCC ATGATCAAAT TCTTCAACCA CGCAAGTACT GTTTCATATT AAATGCTGAT TATACATATA CAACAACCAA ATTTTCATTT AACGAAATAA  AAATGATTTG CTATGAATTA GAAATATACG TTATAATAAA CTGCCCATTT AGATGTGAAG ACCTTATTTA ATGATGTGGT TTTAAAGTTA TAGTTCCAAA AAGAGATAGT TTGTGTAATA  TTAATGTTTT AAAGCTATGG TTCCAAAGTG AAGAAATATT AGCTATAAAG AGAAAGCAGA TGAGATTTGA GTATTTAATA AGCATGAATT TTATTTTATT TTTCTTTAAA TAAGCAAGGA  TAGTATATAT AATTTTCATT AAATAATCAT TGAATAAATT TTAAAATGTT AATCAAATGT TCCAGTACTT TCACATAAAA GCACCGCCGT CAAGCACAAT GCCAACCGTA ACTAAGTTGA  TTCAAGATGT ATTCAATAAT AAGAGAATAA GTGAAAGTAT ATGAAGCAAA TCTTACAAAA TAGTAATACC AAATATGATA CCGCATAGAA TGTGTAAAGC ACACAATTTT AATCTAATTT  ATAATCAAAA TAGAGAATTT ATATTTGAAA TTCAAATGGT TGGTTGCTTT CAGACATTAC AAGTAGATCA TTCATAAGCT TATGTGATAC CATACTTTGA AAATGCTACG CTTAAAACAG  CATCAATACT AATTACTAAT AGTTGAAATG GACATGGATT GACACAGTGT CTTCCACAAA ATACGTGAAT ACGGCCTAAA CCAGTTGACC CTTTTTTTAA AGTTAATCAA TGGATAAGGC  AACAGAAAGT GGCCGCGTAA ATTTTAATAA TTCAGTCAGA AAGCATCATG GGTGTCGCAA TAGTTGACGC GCTAGAAAGT AATCTAAATC CAAATCTTCA TCAGCCACTA AAAACTTGAA  CAAGGGCCCA AAATCTGACC ATCCAAAATT GGTTTCTGTC AGTTAAACAT CCTTCTCAAT TACTCTCAAG CAAATTGGCC CTCTCCTTGC CTCCTCTTGT CATAACAAGA ATGCCCTGTA  CATTGTTGAC ACCAATTCAC TAAACTTAAA AACAGAATCC AATCCCTCTC TCCATTCACA ATCACACACA GCCAAAGAAA TTAAAACAGC CTGACACTCG TAAGCCAAAC CGCCCCACTT 
CATATTTACT TATAAACTCA ACAAAATACT CATTTTGGAC CTCACCCACT TCATTTTGCT TATTTTGCAA GCCCAAGAAG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTTTCGATACTATTCTTCCTTCTACTAATAACCATGGCAACTGCAGACCCTCTCCGGCCTCGATACTACTCGGAGACCTGCCCGGAAGCAGAATCCATCGTCGGAGATGTGATT
ATGAAGGCCATGATTAGAGAACCAAGAAGCGGAGCCTCTGTCATGCGGTTCCAGTTCCATGATTGCTTCGTTAAT
GTAACAACTATACAGAAACCGATTCTCTTATAACAGTGGTAATAA
TAATATGTTTCTGGTCTTGTGGATGATGAATTGTTTATAAAATCTTGACAGGGTTGTGATGCTTCTATGTTGCTTGATGACACACCAACGATGCTTGGAGAAAAATTGTCTCTTTCGAAC
ATTAATTCGCTGAGATCATACGAAGTCATCGATGAGGTCAAAGAAGCATTAGAGAAAGCCTGTCCAGGAACCGTTTCTTGTGCTGATATCATTATCATGGCCTCAAGAGATGCCGTTGCA
CTG
GTAACCCCTAAAAAAAAAAAAATTATTATTATTATTTTTCTTCGAATTAACTTTACCTTAATTTATAATTTAATTTAGGCCAGTCAAAAAATATGGTCGCCCGCAATTAAATAATGC
GAAATGGGTCCTCTCTCCCACTGTCACCTATGTTCTCAAGTTGACAGACATATAATATTCGCCTAATCGTTTTAACTTTAATTCAAAAGTAACAAAGCATGATAACGGGTGCAAAAGTTG
GGTTGATTAGAATATGATTTCTTCGTTTTGCCATCTTACAATATATATATATTTTTTTAATTTTATTTTGTCGAGGATGAATGATGCCTAGCTAGATTATCTTGAATTTGCAGTAATTGC
ATTTGAATTTTGATATATTTCACTAACTTGGATCACTGGAAAAATATATCATTTCTAGAAATTTTTTAGTCTATGAAAGCTATAGCTAGATTATAAATTAATAATTTATTGTCGTTGTCA
ATTGTTTTGACCCGCATTCATTTAATTACTTTGTGAGTCGGTGATCGGCTACCATTTGCAGGCAGAGAGTAAAACCCTACGTTAAAAATGCATAACATATACTACGACTATCCAAAATTT
TGTTTTCATTTTATAGTTTTGATCATTATTTGCAATTTAGTTAATTAACCAGAAGGATGTATGATATGAACAACAAAACTGAGTGGTATCTTGAAACAGAGTGGAGGGCCCAGCTGGGAA
GTGAAGCTGGGAAGAAAAGACAGCTTAACGGCCAGCCAAAAGGATGCGGACGATATCATGCCAAGCCCTAGAGCCAATGCCAGTTTTCTGGTTGACCTGTTTGCCAAATTTGATCTCTCC
ATCAAAGATCTTGTAGCCCTTTCGGGCTCACACTCGATTGGCCAAGGCCGATGTTTTTCGATCATGTTTAGGCTATACAATCAGTCTGGGTCAGGCAAGCCTGACCCTGCCATCGAGCCT
AAGTTCAGAGAAAAGCTAAACAGGCTTTGTCCAATCGGCGGCGATGAGAATGTAACAGTAGACCTTGATGCAACACCTCAAGCTTTTGATAACCAATATTTCAAGGACTTGGTTGCCGGT
AGAGGATTTCTGAACTCTGATGAGACGCTGTATACTTATCCGTGGACTAGACCATATGTGAAGCTTTATGGCAAAGATCAAGACAAATTTTTCAAGGCATTTGTGGAGGGAATGATAAAG
TTGGGTGACTTGCAATCCGGGAAGCCTGGGGAGATTAGAACCAACTGTAGAGTTGTTAACAGCCGGGCTGTGGACGTATTGTTGGAATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTTTCGATACTATTCTTCCTTCTACTAATAACCATGGCAACTGCAGACCCTCTCCGGCCTCGATACTACTCGGAGACCTGCCCGGAAGCAGAATCCATCGTCGGAGATGTGATT
ATGAAGGCCATGATTAGAGAACCAAGAAGCGGAGCCTCTGTCATGCGGTTCCAGTTCCATGATTGCTTCGTTAAT
GGTTGTGATGCTTCTATGTTGCTTGATGACACACCAACGATGCTT
GGAGAAAAATTGTCTCTTTCGAACATTAATTCGCTGAGATCATACGAAGTCATCGATGAGGTCAAAGAAGCATTAGAGAAAGCCTGTCCAGGAACCGTTTCTTGTGCTGATATCATTATC
ATGGCCTCAAGAGATGCCGTTGCACTG
AGTGGAGGGCCCAGCTGGGAAGTGAAGCTGGGAAGAAAAGACAGCTTAACGGCCAGCCAAAAGGATGCGGACGATATCATGCCAAGCCCTAGA
GCCAATGCCAGTTTTCTGGTTGACCTGTTTGCCAAATTTGATCTCTCCATCAAAGATCTTGTAGCCCTTTCGGGCTCACACTCGATTGGCCAAGGCCGATGTTTTTCGATCATGTTTAGG
CTATACAATCAGTCTGGGTCAGGCAAGCCTGACCCTGCCATCGAGCCTAAGTTCAGAGAAAAGCTAAACAGGCTTTGTCCAATCGGCGGCGATGAGAATGTAACAGTAGACCTTGATGCA
ACACCTCAAGCTTTTGATAACCAATATTTCAAGGACTTGGTTGCCGGTAGAGGATTTCTGAACTCTGATGAGACGCTGTATACTTATCCGTGGACTAGACCATATGTGAAGCTTTATGGC
AAAGATCAAGACAAATTTTTCAAGGCATTTGTGGAGGGAATGATAAAGTTGGGTGACTTGCAATCCGGGAAGCCTGGGGAGATTAGAACCAACTGTAGAGTTGTTAACAGCCGGGCTGTG
GACGTATTGTTGGAATCTTGA

Retrieve as FASTA