Entry information : CclPrx41 (clementine0.9_015745m)
Entry ID 8698
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx41 (clementine0.9_015745m)
Name (synonym) CclPrx41 (clementine0.9_015745m)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx41
start..stop
S start..stop
CsPrx44 665 0 1..325 1..325
VvPrx41 526 0 1..325 1..324
GhPrx06 523 0 7..325 12..328
NnPrx13 516 0 8..325 17..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3644023..3644412 390 N° 2 3643674..3643836 163 N° 3 3643008..3643432 425  
complement(join(3643008..3643432,3643674..3643836,3644023..3644412))


exon

Literature and cross-references CclPrx41 (clementine0.9_015745m)
DNA ref. Phytozome 12:   scaffold_14 (3644412..3643008)
Protein sequence: CclPrx41 (clementine0.9_015745m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (304)
PWM (Da):   %s   34901.78 (32725.7)  
PI (pH):   %s   8.49 (8.76) Peptide Signal:   %s   cut: 22 range:22-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGAFAVLVLFVAMAVTSVHCQAGTRVGFYSRSCPRAESIVRSTVQAHFRSDPTIAPGLLRMHFHDCFVHGCDASILTNGPNTEKTAPPNRLLRGYDVIDDAKSQIEAACPGIVSCADILALAARDSVVVTRGISWQVPTGRRDGRISLASDTANLPGFTESVEAQKQKFLDKGLNTQDLVTLVGAHTIGTTACQIFKYRLYNFTTTTATGADPTIDATFIPQLRALCPENGDGARRVALDTGSPNRFDTSFFSNLRNGRGVLESDQKLWSDASTKAVVQRFLGVRGLLGLTFNVEFGRSMVKMSNIGVKTGTDGEIRKICSAIN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTGCTTTTGCAGTACTAGTACTTTTTGTTGCCATGGCTGTGACATCAGTTCATTGCCAAGCAGGGACTCGTGTTGGATTTTATTCAAGGTCATGTCCTCGAGCTGAGTCCATA
GTTAGGTCTACGGTTCAGGCTCATTTCAGGTCTGATCCCACAATTGCTCCTGGGTTACTGAGGATGCATTTTCATGACTGTTTTGTCCACGGTTGTGATGCTTCCATTCTCACTAATGGC
CCCAACACTGAGAAAACTGCACCACCCAATCGTCTGTTGAGAGGATATGATGTAATTGATGATGCCAAATCCCAGATTGAGGCTGCATGTCCTGGCATCGTCTCTTGCGCTGACATTCTT
GCCCTCGCCGCCCGTGATTCTGTCGTCGTG
GTAACAATAATTCTCCACTCTCATCATCATTATTGTTAATAGTTGCCTTAAATACTATTGTTGGGCTTTACTTATCCGCTTAAAATTTTA
AGTCAAATAATTTTTGTAAACAATATCAGAGCCAAATTCTCAAGTTTGATTCACTTTACGTACAAACTAACATATTTTGTTGGACATGCATTGCAGACAAGAGGAATAAGTTGGCAAGTG
CCCACAGGACGCAGAGATGGCAGGATATCATTGGCATCCGATACTGCCAATCTTCCAGGTTTCACCGAGTCTGTTGAAGCGCAAAAGCAAAAGTTTCTTGACAAGGGTTTGAACACTCAG
GATCTTGTTACTCTTGTTG
GTAAGCACCAAATCAAATTAACTCATTTATATAGTGATTATCAAGTGCGGGCACCCATAACTTATAAAGCATGGATTTGAACCGATGGACATTTTTCTACG
ACCTCATAGTTCAAATCCGTACTTTATAAGATAGAAGAACTAATAAATAAAAAATTCCTTTATGATCTGAGCTACTAAATTAAATTTATATGGATGATTGGTGGTTAAAAAATTTAACTT
TTACCTCTATTTGTTACCAGGAGCACATACAATCGGTACTACAGCTTGCCAAATATTTAAGTACAGACTTTATAACTTCACTACAACAACAGCAACAGGAGCTGATCCAACCATAGACGC
TACGTTCATTCCTCAACTCCGAGCACTCTGTCCGGAGAACGGTGACGGAGCAAGGCGCGTTGCACTTGACACCGGTAGCCCTAATAGATTCGACACGTCCTTCTTCTCGAATTTGAGAAA
CGGGCGGGGAGTGCTAGAGTCTGATCAGAAGCTATGGAGTGATGCTTCTACTAAAGCGGTCGTGCAAAGGTTCTTGGGTGTGAGAGGATTGCTAGGGCTGACCTTCAATGTGGAGTTTGG
AAGATCCATGGTTAAAATGAGTAACATTGGCGTCAAGACTGGCACTGATGGTGAAATTCGCAAAATATGTTCCGCAATTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTGCTTTTGCAGTACTAGTACTTTTTGTTGCCATGGCTGTGACATCAGTTCATTGCCAAGCAGGGACTCGTGTTGGATTTTATTCAAGGTCATGTCCTCGAGCTGAGTCCATA
GTTAGGTCTACGGTTCAGGCTCATTTCAGGTCTGATCCCACAATTGCTCCTGGGTTACTGAGGATGCATTTTCATGACTGTTTTGTCCACGGTTGTGATGCTTCCATTCTCACTAATGGC
CCCAACACTGAGAAAACTGCACCACCCAATCGTCTGTTGAGAGGATATGATGTAATTGATGATGCCAAATCCCAGATTGAGGCTGCATGTCCTGGCATCGTCTCTTGCGCTGACATTCTT
GCCCTCGCCGCCCGTGATTCTGTCGTCGTG
ACAAGAGGAATAAGTTGGCAAGTGCCCACAGGACGCAGAGATGGCAGGATATCATTGGCATCCGATACTGCCAATCTTCCAGGTTTCACC
GAGTCTGTTGAAGCGCAAAAGCAAAAGTTTCTTGACAAGGGTTTGAACACTCAGGATCTTGTTACTCTTGTTG
GAGCACATACAATCGGTACTACAGCTTGCCAAATATTTAAGTACAGA
CTTTATAACTTCACTACAACAACAGCAACAGGAGCTGATCCAACCATAGACGCTACGTTCATTCCTCAACTCCGAGCACTCTGTCCGGAGAACGGTGACGGAGCAAGGCGCGTTGCACTT
GACACCGGTAGCCCTAATAGATTCGACACGTCCTTCTTCTCGAATTTGAGAAACGGGCGGGGAGTGCTAGAGTCTGATCAGAAGCTATGGAGTGATGCTTCTACTAAAGCGGTCGTGCAA
AGGTTCTTGGGTGTGAGAGGATTGCTAGGGCTGACCTTCAATGTGGAGTTTGGAAGATCCATGGTTAAAATGAGTAACATTGGCGTCAAGACTGGCACTGATGGTGAAATTCGCAAAATA
TGTTCCGCAATTAACTAA

Retrieve as FASTA