Entry information : CclPrx48 (clementine0.9_016030m)
Entry ID 8704
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx48 (clementine0.9_016030m)
Name (synonym) CclPrx48 (clementine0.9_016030m)
Class Class III peroxidase    [Orthogroup: Prx041]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx48
start..stop
S start..stop
CsPrx07 653 0 1..319 1..319
CppPrx06 649 0 3..319 1..317
LcPrx01 523 0 1..319 1..317
GrPrx25 494 3e-178 9..319 17..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2940541..2940756 216 N° 2 2940840..2941031 192 N° 3 2941197..2941362 166 N° 4 2941828..2942213 386
join(2940541..2940756,2940840..2941031,2941197..2941362,2941828..2942213)


exon

Literature and cross-references CclPrx48 (clementine0.9_016030m)
DNA ref. Phytozome 12:   scaffold_23 (2940541..2942213)
Protein sequence: CclPrx48 (clementine0.9_016030m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (301)
PWM (Da):   %s   34492.78 (32473.7)  
PI (pH):   %s   10.13 (10.23) Peptide Signal:   %s   cut: 19 range:19-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATSYYFLLLILTFVTATLDQANSQLSTNYYKSTCPKALSIVRAGIIAAIKNETRVGASLLRLHFHDCFVNGCDGSVLLDDTANFIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVVFGGPSWKVRLGRRDSTTASRAAANTSIPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDNLYYKNLLNKKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQIRINCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAACAAGTTACTACTTTCTCCTTCTTATACTTACTTTTGTCACTGCAACTCTTGATCAAGCCAACTCCCAACTCTCAACAAACTACTACAAATCCACATGCCCAAAAGCATTG
TCTATTGTTCGGGCAGGGATTATAGCTGCTATAAAAAATGAAACACGCGTAGGGGCGTCTTTACTTCGACTTCATTTCCACGACTGCTTTGTCAAT
GTATGCTTTGTTTGTTTTCGGTCG
TTTGTCTGTTTTGTGTTATAATTAGTCTTAAGCTATTTCAACTGATTGATGACAATCAGGGCTGCGATGGATCGGTACTGTTGGATGATACGGCCAATTTCATAGGAGAGAAAACAGCAG
TTCCTAACAATAACTCGGCCAGAGGGTTCAACGTGGTGGATCAGATTAAAGCTAATCTGGAGAAAGCATGCCCCCGTGTTGTTTCGTGTGCAGATATTCTTGCCATTGCCGCACGCGATT
CAGTTGTTGTT
GTAAGCTCCCGCTAGTCTCCATGTTAATTATATTGATGAAGATCTTGAAATCTCCAATCTTGACTATCATCAAGTCTCCTGCATGTACTAATTTATCCACTTGCTTCNN
NNNNNNNNNNNNNNNNNNNNNNNGGGTGGGGCAACGTTTCTTTGGCACAATTGCAGTTCGGAGGTCCTTCATGGAAAGTTAGATTGGGAAGAAGAGATTCTACCACTGCTAGCAGGGCAG
CGGCAAATACCTCCATCCCTCCACCCACTTCTAATTTGAGTGCTCTCATATCAAGCTTCTCGGCACAGGGTCTCTCATTAAAGAACATGGTGGCTCTTGCTG
GTAATTCAACTGTAGTTA
TTACTTGGTCTACACTAATATGCTACAAATTAAATTCAGTGAATCCCTTAACTTAGGTTGTGTTTGGAATTGAGGTTGGACAGCTGTAGCTTAAAAGTTACAGCACTAAAGTGTGTGTTT
GGAATTGAGGTTGGACAGCTGTAGCTTAAAAGTTACAGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNACACCCTTAATCACATACTGCAACTCTCAGCAGACCAATTAATTGACAGAGCTCATCTTATGTATATGGCCATTGGCAGGTGGACATACGGTAGGCAAGGCAAGGTGCACAT
CATTTCGAGGACACATTTACAACGATTCCAATATTGACACCAGCTTCGCCAGGTCCTTGCAGCAGAGATGCCCAAGAAGAGGAAATGACAATGTTCTGGCAAACCTTGACCGTCAAACTC
CAACGTGCTTTGACAATTTATATTACAAGAATCTGTTGAACAAGAAGGGGCTTCTTCATTCTGACCAAGAGCTCTTTAATGGCAATTCTGCTGATTTTCTGGTCAAAAGATACGCTGCTA
GCATCTCTGTTTTTTTCAAGGACTTCGCCAGGGGTATGATCAAGATGGGCAACATCAAACCTCTCACAGGAAGTGCTGGACAGATCAGGATCAATTGCAGAAAAATCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAACAAGTTACTACTTTCTCCTTCTTATACTTACTTTTGTCACTGCAACTCTTGATCAAGCCAACTCCCAACTCTCAACAAACTACTACAAATCCACATGCCCAAAAGCATTG
TCTATTGTTCGGGCAGGGATTATAGCTGCTATAAAAAATGAAACACGCGTAGGGGCGTCTTTACTTCGACTTCATTTCCACGACTGCTTTGTCAAT
GGCTGCGATGGATCGGTACTGTTG
GATGATACGGCCAATTTCATAGGAGAGAAAACAGCAGTTCCTAACAATAACTCGGCCAGAGGGTTCAACGTGGTGGATCAGATTAAAGCTAATCTGGAGAAAGCATGCCCCCGTGTTGTT
TCGTGTGCAGATATTCTTGCCATTGCCGCACGCGATTCAGTTGTTGTT
TTCGGAGGTCCTTCATGGAAAGTTAGATTGGGAAGAAGAGATTCTACCACTGCTAGCAGGGCAGCGGCAAAT
ACCTCCATCCCTCCACCCACTTCTAATTTGAGTGCTCTCATATCAAGCTTCTCGGCACAGGGTCTCTCATTAAAGAACATGGTGGCTCTTGCTG
GTGGACATACGGTAGGCAAGGCAAGG
TGCACATCATTTCGAGGACACATTTACAACGATTCCAATATTGACACCAGCTTCGCCAGGTCCTTGCAGCAGAGATGCCCAAGAAGAGGAAATGACAATGTTCTGGCAAACCTTGACCGT
CAAACTCCAACGTGCTTTGACAATTTATATTACAAGAATCTGTTGAACAAGAAGGGGCTTCTTCATTCTGACCAAGAGCTCTTTAATGGCAATTCTGCTGATTTTCTGGTCAAAAGATAC
GCTGCTAGCATCTCTGTTTTTTTCAAGGACTTCGCCAGGGGTATGATCAAGATGGGCAACATCAAACCTCTCACAGGAAGTGCTGGACAGATCAGGATCAATTGCAGAAAAATCAATTGA

Retrieve as FASTA