Entry information : CclPrx52 (clementine0.9_016210m)
Entry ID 8708
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx52 (clementine0.9_016210m)
Name (synonym) CclPrx52 (clementine0.9_016210m)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx52
start..stop
S start..stop
CsPrx37 644 0 1..316 1..316
PtPrx74 474 1e-170 7..315 12..320
StPrx34 468 6e-168 6..315 9..319
LePrx22 466 3e-167 6..315 8..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2387836..2388039 204 N° 2 2388151..2388345 195 N° 3 2389491..2390042 552  
join(2387836..2388039,2388151..2388345,2389491..2390042)


exon

Literature and cross-references CclPrx52 (clementine0.9_016210m)
DNA ref. Phytozome 12:   scaffold_2 (2387836..2390042)
Protein sequence: CclPrx52 (clementine0.9_016210m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (295)
PWM (Da):   %s   34231.56 (31952.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.96 (8.80) Peptide Signal:   %s   cut: 22 range:22-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYRGIFHVVLILAFAATAFSTLSPCYYDKVCPEALPTIKRIVEAAVEKEGRMGASLLRLHFHDCFVQGCDASILLDDTSTIDSEKNAIPNNNSVRGFEVIDLIKKELDKVCKRPVVSCADILAVAARDSVVALGGPTWKVPLGRRDSTTANRTLANNDIPSPFLNLTGLISSFRRQGLNETDLVALSGGHTIGFARCSAFRNRIYNATNIDPDFAKERQRTCPSTGGDSNLAPFDPTPLTFDGKYFSSLLQKRGLLISDQALFNGGSTDGLVKTYSLNFKAFSAGFANSMIKMGNINVLTGNKGQIRSNCRRVNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATAGAGGCATATTTCATGTCGTCCTCATTTTGGCTTTTGCAGCTACAGCTTTCTCAACCCTTTCTCCTTGCTACTATGATAAAGTTTGTCCCGAAGCTTTGCCAACAATCAAA
CGAATAGTTGAAGCTGCTGTGGAAAAAGAAGGCCGCATGGGTGCTTCCTTACTTCGTCTCCACTTCCATGATTGTTTTGTTCAA
GTACGCATATTAACCCTAATTAACTTAACTGCTAAA
CATTTTCTTTATCGTTCTCACATCGTCGATTGTGTTTTAATTCTTGTATACATGTTCTTTGTGATCTATATATAGGGTTGTGATGCCTCCATTCTTCTTGATGACACGTCCACCATTGAT
AGTGAAAAGAATGCAATTCCAAATAATAATTCCGTTAGAGGATTCGAGGTCATCGACCTGATAAAGAAAGAGCTCGACAAAGTTTGCAAACGCCCAGTTGTTTCTTGTGCAGATATCTTG
GCTGTAGCAGCTCGCGATTCTGTTGTTGCT
GTGAGTAGTTAAATTTCCCTCTAATCTTTGTTCAATCATAGGTCCGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNCAGTTGTTCACATAATAAATTGCATGCAATAACACGTATGAAAGCTTATGTAAGACAAGACTCTATCTGTATTATTAAAGACACAATTTTTAGA
GTATTTGATAAACACTCATATTTATGATTCCCAGGCTAAAGGGATTATGTTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGAACACAAT
GACATATTTCACAATGATTGTGTACCACTCTAAAAACTGTCTTTAATAATACAGATAGAGTCTTGTCTTACATAAGCTTTCATACGTGTTATTACATGCAATTTATTATGTGAACATTAA
GGATTAGTTTGGTAATACTATTTGATAAACACTCATATTTTATGATTCCTAGACTAAAGGAATTGTGTTTTGATAAAATCTTATAATACTTTTACTAGGAAAAATTATTTTAATTTTTAC
CAAACACAATGACATATTTCACAATGATCGTGTACCACGATACTTAACCACGCCCTTTCATGAATTTGGGCTAATTGTGTTTTACAAATTTGCAGCTAGGAGGACCAACATGGAAGGTGC
CTCTAGGGAGAAGAGACTCAACAACAGCAAACAGAACCCTAGCCAACAATGACATCCCATCGCCATTCCTCAACCTCACTGGATTAATCAGCAGCTTCAGAAGACAAGGCCTTAACGAGA
CGGACTTAGTGGCTCTCTCCGGTGGCCACACTATTGGCTTTGCTCGGTGCAGTGCCTTTCGAAACCGCATATACAACGCAACAAACATCGACCCCGACTTTGCTAAAGAGCGCCAAAGGA
CTTGCCCGAGCACAGGAGGAGACTCGAACCTCGCACCTTTTGACCCAACGCCATTAACCTTCGATGGCAAATATTTTTCTAGTCTGTTGCAGAAACGAGGGCTACTTATCTCAGATCAAG
CACTTTTCAATGGGGGCTCAACCGATGGGCTTGTTAAAACTTATAGCCTTAATTTCAAAGCCTTCTCTGCTGGTTTTGCAAACTCTATGATCAAGATGGGGAACATTAACGTTTTGACAG
GGAATAAAGGTCAAATTCGTTCGAACTGCAGGAGGGTGAACAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATAGAGGCATATTTCATGTCGTCCTCATTTTGGCTTTTGCAGCTACAGCTTTCTCAACCCTTTCTCCTTGCTACTATGATAAAGTTTGTCCCGAAGCTTTGCCAACAATCAAA
CGAATAGTTGAAGCTGCTGTGGAAAAAGAAGGCCGCATGGGTGCTTCCTTACTTCGTCTCCACTTCCATGATTGTTTTGTTCAA
GGTTGTGATGCCTCCATTCTTCTTGATGACACGTCC
ACCATTGATAGTGAAAAGAATGCAATTCCAAATAATAATTCCGTTAGAGGATTCGAGGTCATCGACCTGATAAAGAAAGAGCTCGACAAAGTTTGCAAACGCCCAGTTGTTTCTTGTGCA
GATATCTTGGCTGTAGCAGCTCGCGATTCTGTTGTTGCT
CTAGGAGGACCAACATGGAAGGTGCCTCTAGGGAGAAGAGACTCAACAACAGCAAACAGAACCCTAGCCAACAATGACATC
CCATCGCCATTCCTCAACCTCACTGGATTAATCAGCAGCTTCAGAAGACAAGGCCTTAACGAGACGGACTTAGTGGCTCTCTCCGGTGGCCACACTATTGGCTTTGCTCGGTGCAGTGCC
TTTCGAAACCGCATATACAACGCAACAAACATCGACCCCGACTTTGCTAAAGAGCGCCAAAGGACTTGCCCGAGCACAGGAGGAGACTCGAACCTCGCACCTTTTGACCCAACGCCATTA
ACCTTCGATGGCAAATATTTTTCTAGTCTGTTGCAGAAACGAGGGCTACTTATCTCAGATCAAGCACTTTTCAATGGGGGCTCAACCGATGGGCTTGTTAAAACTTATAGCCTTAATTTC
AAAGCCTTCTCTGCTGGTTTTGCAAACTCTATGATCAAGATGGGGAACATTAACGTTTTGACAGGGAATAAAGGTCAAATTCGTTCGAACTGCAGGAGGGTGAACAACTAA

Retrieve as FASTA