Entry information : CclPrx68 (clementine0.9_020145m)
Entry ID 8712
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx68 (clementine0.9_020145m)
Name (synonym) CclPrx68 (clementine0.9_020145m)
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx68
start..stop
S start..stop
CsPrx54 682 0 1..349 1..349
CclPrx05 661 0 1..349 1..350
CsPrx52 661 0 1..349 1..350
CsPrx61 656 0 1..349 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1143183..1143401 219 N° 2 1142589..1142780 192 N° 3 1141828..1141996 169 N° 4 1140830..1141299 470
complement(join(1140830..1141299,1141828..1141996,1142589..1142780,1143183..1143 401))


exon

Literature and cross-references CclPrx68 (clementine0.9_020145m)
DNA ref. Phytozome 12:   scaffold_31 (1143401..1140830)
Protein sequence: CclPrx68 (clementine0.9_020145m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (323)
PWM (Da):   %s   37737.9 (35108.5)  
PI (pH):   %s   5.41 (5.39) Peptide Signal:   %s   cut: 27 range:27-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLRYLIAAALVVAFVLEGSSPAQAQLSPFFYSSTCPNVTNIIREVLQNAFLSDIRIGASLIRLHFHDCFVNGCDASILLDNTTTIDSEKFAAPNNNSARGFEVVDDMKAAVERACPGVVSCADILTIAAEESVALSGGPAWTNLLGRRDSRTANRTLANENLPGPNNSLERLKDRFRNVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGGNGSVLTNLDVTTPDLFDNKYFFNLQISKGLLQSDQELFSTPGADTTAIVNVFSSNQAAFFKSFVISMIRMGNLKPLTGNQGEIRSNCRRVNGNSNIETRSSSEGDLISSF

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing which has been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTTCGTTATCTTATTGCAGCTGCTCTTGTAGTTGCATTTGTGCTTGAGGGATCATCACCAGCCCAAGCTCAACTTTCTCCCTTTTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGGGAGGTGCTTCAGAATGCTTTCTTGTCCGATATTCGTATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTTGTTAAT
GTAATCAATCTCCACTCTTTG
ATTTTTCTTCTTCTTCAATTAATATTTTAAAACACGAGTTAAAGTCCTCTCCTAATATGAATTCTGCTTACTATTTTTTAAAAATCTTGTGTAACAAGTCTATTATTAGTAATATATGAT
TGAAATATAACCACGTACACTTATATCCTTACCTTCTAATAATCACAATTAAGCTCAGGAAAAGCTTACGTCATGAGGGGATCATGGTCTTCAAAACTTATATTACAATAAGGCAATTTG
TATATATGTATGTTTATTCAAAAAAGAAAATGCACAAGTTTGCATTATTTTTCTTAATCGTAAGATAAGAAGAATCTACCTAATTATTAAATTAACGATACAACAGCAGTTGATCACAAC
AAGTTTTTGATGTTATTTCAGGGCTGTGATGCATCGATTTTGCTGGACAATACTACTACCATAGACAGCGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTTGAAGTTGTT
GATGACATGAAAGCTGCCGTTGAAAGGGCCTGTCCAGGCGTTGTTTCCTGTGCTGATATTCTTACTATTGCAGCTGAAGAATCTGTTGCTCTG
GTATGTGTGAATTTCTATTAACAACTC
CTCATCTTTCTCGACTACATATTTTATGCTTAAAAGTGATTAAATTACTATGGTATCAGAGTGTAAGTTTGACTTTACATTCGTGTTGGAATTTTCAGACCCTGAGTACTTTAACTAAAT
GAATCCACATGCTTAGTTTTGAGCGGCAACAGTCCCATCGAATTACCATGTTGACTTCGTGATAGCCCCGGGCCAAATTTTCCGTTTGAAAAGGGGAGGGTTTTTCTTTNNNNNNNNNNN
NNNNNNNNNNNNNNNAAAAAAAAAACACAAAAAAAAACGGTGATGCGATTCATCGAGGACACATCAGTTTTACGTGCTGGGTTCCAGTATATATTTTGAAAAAAAAAAAAAATTCTTCTT
TATATGATACAGTCTGGTTGAACCGTTCACTCAAAATTATAACGTCGGGAAACTGCTAATTTTGGGTGCAACAAGACCCATATAAATATTAGCCAAATAGAGTCGGAAAGATTAATTGCA
TGTGTCTTTCTAATTTTAGTTAAATTTGTTTATTATGCATCTCTCAAGTGATGCTTTTGACTAATGATCGTGGTTTTGGTAACAGTCAGGGGGTCCTGCATGGACAAATCTATTGGGAAG
AAGAGACAGCAGAACAGCAAACAGGACTCTTGCAAATGAAAATCTTCCAGGACCGAACAATAGTCTTGAGAGGCTCAAAGATAGATTCAGAAATGTTGGCCTCAACGACAATTTTGATCT
TGTTGCACTCTCCG
GTAATATTTGCTTTTACGCCCTTTGACTTGAGTACAAACAGACCTTGGAGTCTTTTGGGATAAAGCAGTATTGGAGCCAGAATTAGAAATCTGGATGGTGGAAAAT
TTTTTAATGCCAATACTGAGTCTTGAAATCTTAGAGATAGTTTAAATGTTGAATATCTTATTTAAAAAGAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNTTACTAAGACGACCACCGACACAAAGCACATTCATACTCTACAGCACCTAGGAGGCTTGACTGAATATCCTAATGATGCGAAGAAACTGTGTTTTAAAGTTT
GACATTGGTGATTAGGAATATGTTAAAACGTTTGACAAATTTACTCCCCTTAATCACATCATGAAATTTGAATTGCTTCCCAAAAAGAAAAGTGAGAACCACCATAATGAAACTCAGTTA
TTATCCTTAATTTGTATGAATTTGAGTAAAAATAACAAAGATCGGCTATGCATGTTTTTCAGGAGCTCACACGTTTGGAAGGGCTCAGTGCCGAACTTTTAGCGATAGATTATTCAATTT
CAACAACACTGGCAATCCAGACCCAACACTTAACACAACCCTCTTACAGCAACTTAGGCAACTATGCCCACAAGGTGGAAACGGCAGCGTTCTAACTAATCTTGATGTCACAACACCTGA
TTTGTTTGACAACAAATACTTCTTCAATCTTCAAATCAGCAAGGGCCTTCTGCAGAGTGATCAAGAGTTGTTTTCGACTCCCGGTGCCGATACCACTGCCATTGTCAATGTCTTTAGTAG
CAACCAGGCTGCTTTCTTTAAAAGCTTTGTGATTTCAATGATAAGAATGGGGAATTTGAAACCATTGACAGGCAATCAAGGGGAGATTAGATCGAACTGCAGGAGGGTCAACGGAAACAG
TAATATAGAAACCAGATCATCGTCAGAGGGTGATTTGATCAGCTCTTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTTCGTTATCTTATTGCAGCTGCTCTTGTAGTTGCATTTGTGCTTGAGGGATCATCACCAGCCCAAGCTCAACTTTCTCCCTTTTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGGGAGGTGCTTCAGAATGCTTTCTTGTCCGATATTCGTATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTTGTTAAT
GGCTGTGATGCATCGATTTTG
CTGGACAATACTACTACCATAGACAGCGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTTGAAGTTGTTGATGACATGAAAGCTGCCGTTGAAAGGGCCTGTCCAGGCGTT
GTTTCCTGTGCTGATATTCTTACTATTGCAGCTGAAGAATCTGTTGCTCTG
TCAGGGGGTCCTGCATGGACAAATCTATTGGGAAGAAGAGACAGCAGAACAGCAAACAGGACTCTTGCA
AATGAAAATCTTCCAGGACCGAACAATAGTCTTGAGAGGCTCAAAGATAGATTCAGAAATGTTGGCCTCAACGACAATTTTGATCTTGTTGCACTCTCCG
GAGCTCACACGTTTGGAAGG
GCTCAGTGCCGAACTTTTAGCGATAGATTATTCAATTTCAACAACACTGGCAATCCAGACCCAACACTTAACACAACCCTCTTACAGCAACTTAGGCAACTATGCCCACAAGGTGGAAAC
GGCAGCGTTCTAACTAATCTTGATGTCACAACACCTGATTTGTTTGACAACAAATACTTCTTCAATCTTCAAATCAGCAAGGGCCTTCTGCAGAGTGATCAAGAGTTGTTTTCGACTCCC
GGTGCCGATACCACTGCCATTGTCAATGTCTTTAGTAGCAACCAGGCTGCTTTCTTTAAAAGCTTTGTGATTTCAATGATAAGAATGGGGAATTTGAAACCATTGACAGGCAATCAAGGG
GAGATTAGATCGAACTGCAGGAGGGTCAACGGAAACAGTAATATAGAAACCAGATCATCGTCAGAGGGTGATTTGATCAGCTCTTTCTAA

Retrieve as FASTA