Entry information : CclPrx77 (clementine0.9_022835m)
Entry ID 8713
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-05 (Qiang Li)
Peroxidase information: CclPrx77 (clementine0.9_022835m)
Name (synonym) CclPrx77 (clementine0.9_022835m)
Class Class III peroxidase     [Orthogroup: Prx018]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx77
start..stop
S start..stop
CsPrx54 527 0 1..288 1..349
CclPrx68 491 6e-177 1..288 1..349
CclPrx05 490 1e-176 1..288 1..350
CsPrx52 487 2e-175 1..288 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1072859..1073077 219 N° 2 1072379..1072456 78 N° 3 1070319..1070418 100 N° 4 1069336..1069805 470
complement(join(1069336..1069805,1070319..1070418,1072379..1072456,1072859..1073 077))


exon

Literature and cross-references CclPrx77 (clementine0.9_022835m)
DNA ref. Phytozome 12:   scaffold_31 (1073077..1069336)
Protein sequence: CclPrx77 (clementine0.9_022835m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   288 (262)
PWM (Da):   %s   31463.94 (28834.5)  
PI (pH):   %s   8.12 (8.13) Peptide Signal:   %s   cut: 27 range:27-288
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLRYLLAAALVVAFVLEGSSPAQAQLSPFFYSSTCPNVTNIIREVLKNAFLSDIRIGASLIRLHFHDCFVNGCDASILLDNTTTIVSEKFAGPNINSMKNLPGPNNTLTRLKDRFRNVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGGNGSVLTNLDVTTPDLFDNKYFFNLQIRKGLLQSDQELFSTPGADTAAIVNVFSSNQAAFFQSFVISMIRMGNLRPLTGNQGEIRLNCRRVNGNSNIETRSSSEGDLISSF

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (A big gap in frame because of 'NNNNNNN' in DNA sequence).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTTCGTTATCTTCTTGCAGCTGCTCTTGTAGTTGCATTTGTGCTTGAGGGATCATCACCAGCTCAAGCTCAACTTTCTCCCTTTTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGGGAGGTGCTTAAGAATGCTTTCTTGTCCGATATCCGGATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTTGTTAAT
GTAATCAATCTCTACTCTTTA
ATTTTTCTTCTTCTTCAATTAATATTTTAAAACATGAATTAAGGTCCTCTCCTAATCTGAATTCTGCATAGTATTTTTAAAAATTTTGTGTAACATGCCTATTATTAGTAGCATATGATT
GAACTATAACTACATACACTTATATCCTTAACTTCTAATAATCACAATTAAACTCGGAAAAAGCTTACGTCACGAGGATATCCTGGTTTTAAAAACTTATTATACAATAAGAAAATTTGT
ATATATGTGTATGTTTATCCAAAAAGAAAATGCACAAATATTCATTATTTTTCTTAATCGTAAGATAAGAAGAATCTACCTAATTATTAAATTAACGATACAACAGCAGTTGATCAGAAA
GAGTTTTTGACGTTATTTCAGGGCTGTGATGCATCGATTTTGCTGGACAATACTACTACCATAGTGAGCGAGAAATTTGCTGGGCCAAATATTAATTCGGCGNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGCAGAACC
GCAACCAGGATTCTTGCAAATGAAAAATCTTCCAGGACCGAACAATACTCTTACGAGGCTCAAAGATAGATTCAGAAATGTTGGCCTCAACGATAATTTTGATCTTGTTGCACTCTCCGG
TAATATTTGCTTTTACGCCCTTTGACTTGAGTACAAACAGACCTTGGAGTCTTTTGGGATAAAGCAGTATTGGAGCCAGAATTAGAAATCTGGAGGTGGAAAATTTTTTAATGCCAATAC
TGAGTCTTGAAATCTTAGAGATAGTTTAAATGTTGAATATCTTATTTAAAAAGAAAAAAATAAATTTTGATAAGGATGTCTCATCCACTAAATATCAATTTTTTTCTCATTATTACTCTT
ACTAAGACGACCACCGACACAAAGCACATTCATACTCTACAGCACCTAGGAGGCTTGACTGAATATCCTAATGATGCGAAGAAACTGTGTTTTAAAGTTTGACATTGGTGATTAGGAATA
TGTTAAAACGTTTGACAAATTTACTCCCCTTAATCACATCATGAAATTTGAATTGCTTCCCAAGAGAACCACCATAATGAAACTCAATTATTATCCTTAATTTGTATGAATTTGAGTAAA
AATAACAAAGATTGGCTATGCATGTTTTTCAGGAGCTCACACATTTGGAAGGGCTCAGTGCCGAACTTTTAGCGATAGGTTATTCAATTTCAACAACACTGGCAATCCAGACCCAACACT
TAACACAACCCTCTTACAACAACTTAGGCAACTATGCCCACAAGGTGGAAACGGCAGCGTTCTAACTAATCTGGATGTCACAACACCTGATTTGTTTGACAACAAATACTTCTTCAATCT
TCAAATCCGCAAGGGCCTTCTGCAGAGTGATCAAGAATTGTTTTCGACTCCCGGTGCCGATACCGCTGCCATTGTCAATGTCTTTAGTAGCAACCAGGCTGCTTTCTTTCAAAGCTTTGT
GATTTCAATGATAAGAATGGGGAATTTGAGACCATTGACAGGCAATCAAGGGGAGATTAGATTGAACTGCAGGAGGGTCAATGGAAACAGTAATATAGAAACCAGATCATCGTCAGAGGG
TGATCTGATCAGCTCTTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTTCGTTATCTTCTTGCAGCTGCTCTTGTAGTTGCATTTGTGCTTGAGGGATCATCACCAGCTCAAGCTCAACTTTCTCCCTTTTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGGGAGGTGCTTAAGAATGCTTTCTTGTCCGATATCCGGATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTTGTTAAT
GGCTGTGATGCATCGATTTTG
CTGGACAATACTACTACCATAGTGAGCGAGAAATTTGCTGGGCCAAATATTAATTCG
ATGAAAAATCTTCCAGGACCGAACAATACTCTTACGAGGCTCAAAGATAGATTCAGAAATGTT
GGCCTCAACGATAATTTTGATCTTGTTGCACTCTCCG
GAGCTCACACATTTGGAAGGGCTCAGTGCCGAACTTTTAGCGATAGGTTATTCAATTTCAACAACACTGGCAATCCAGACCCA
ACACTTAACACAACCCTCTTACAACAACTTAGGCAACTATGCCCACAAGGTGGAAACGGCAGCGTTCTAACTAATCTGGATGTCACAACACCTGATTTGTTTGACAACAAATACTTCTTC
AATCTTCAAATCCGCAAGGGCCTTCTGCAGAGTGATCAAGAATTGTTTTCGACTCCCGGTGCCGATACCGCTGCCATTGTCAATGTCTTTAGTAGCAACCAGGCTGCTTTCTTTCAAAGC
TTTGTGATTTCAATGATAAGAATGGGGAATTTGAGACCATTGACAGGCAATCAAGGGGAGATTAGATTGAACTGCAGGAGGGTCAATGGAAACAGTAATATAGAAACCAGATCATCGTCA
GAGGGTGATCTGATCAGCTCTTTCTAA

Retrieve as FASTA