Entry information : CclPrx86 (clementine0.9_028121m)
Entry ID 8717
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-03 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: CclPrx86 (clementine0.9_028121m)
Name (synonym) CclPrx86 (clementine0.9_028121m)
Class Class III peroxidase     [Orthogroup: Prx017]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx86
start..stop
S start..stop
CsPrx63 374 1e-134 1..184 1..184
CclPrx116 371 9e-132 1..202 1..202
GmPrx172 287 2e-98 1..202 1..203
GmPrx03 286 4e-98 1..202 1..202
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1009032..1009232 201 N° 2 1008719..1008901 183 N° 3 1008431..1008598 168  
complement(join(1008431..1008598,1008719..1008901,1009032..1009232))


exon

Literature and cross-references CclPrx86 (clementine0.9_028121m)
DNA ref. Phytozome 12:   scaffold_78 (1009232..1008431)
Protein sequence: CclPrx86 (clementine0.9_028121m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   202 (182)
PWM (Da):   %s   21384.88 (19124.6)  
PI (pH):   %s   4.58 (4.48) Peptide Signal:   %s   cut: 21 range:21-202
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALFYALLFALVFLIRYSAGQLKIGFYSETCPEAESIVSSVVQDAVVSDPNLAAVLLRLHFHDCFVEGCDGSILIENGPNAEKHAFGHQGVGGFEVVEKAKARSEDACPGVVSCADIVALAARDAIALSNGPSYQVPTGRRDGEVSNVTLADDMPDVSDSIQQLKTKFLHKGLSEKDLVLLSGMLSLSLSLSLSLSLSLMHL

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (A long 3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCTATTTTATGCATTGCTGTTTGCATTAGTATTTTTAATCCGCTACTCTGCTGGGCAGCTCAAAATCGGCTTTTATTCTGAAACATGCCCTGAAGCAGAGTCTATTGTCAGTAGT
GTAGTTCAAGATGCAGTTGTCTCAGACCCCAACTTGGCCGCAGTCTTGCTTAGGCTCCATTTCCATGATTGCTTCGTTGAG
GTCTTCTGTAACCATAATTATTTCTGCCTGTCTTTTTTC
TTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAAACTGTTTGCTAGGGGTGCGATGGATCAATTCTAATAGAGAA
CGGTCCAAATGCTGAGAAGCATGCATTTGGTCACCAAGGTGTTGGAGGGTTTGAAGTAGTAGAAAAAGCCAAGGCCCGCTCGGAAGATGCATGCCCAGGAGTTGTGTCTTGTGCAGATAT
TGTGGCCTTGGCAGCTCGAGATGCTATAGCTCTA
GTTTGTTTAACTCCNNNNNNNNNNNNNNNNNNNNNNNCATCTAATTTCTTTACATTTAAGCTATCGTACGTACGCTATCGTCAATT
AAAGATTAATATAATTAATAATTGATGAATGCAGTCAAATGGACCGAGCTACCAGGTTCCAACCGGGCGCAGAGATGGTGAAGTTTCAAATGTTACGCTGGCAGATGATATGCCCGATGT
TAGTGATTCAATTCAGCAACTCAAGACTAAGTTTTTGCACAAAGGGCTATCGGAGAAGGATCTAGTACTTCTTAGCGGTATG

Retrieve as FASTA