Entry information : CclPrx87 (clementine0.9_028447m)
Entry ID 8718
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx87 (clementine0.9_028447m)
Name (synonym) CclPrx87 (clementine0.9_028447m)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx87
start..stop
S start..stop
CclPrx102 650 0 1..319 1..319
PtPrx39 464 2e-166 1..319 1..319
PpePrx54 458 6e-164 1..319 1..322
PpePrx43 454 2e-162 1..319 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 637522..637731 210 N° 2 637917..638111 195 N° 3 638739..639293 555  
join(637522..637731,637917..638111,638739..639293)


exon

Literature and cross-references CclPrx87 (clementine0.9_028447m)
DNA ref. Phytozome 12:   scaffold_81 (637522..639293)
Protein sequence: CclPrx87 (clementine0.9_028447m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (296)
PWM (Da):   %s   34527.28 (32152.9) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.66 (7.29) Peptide Signal:   %s   cut: 24 range:24-319
Sequence 360
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAIKSFVVYFVLAAAAIIPINAQLTPNFYEKMCPQALPTIRTVVRNAITNETRMGASLLRLHFHDCFVNGCDGSLLLDDTANFVGEKTAIPNNNSVRGFDVIDEIKQAVNTACKGNVVSCADIVAVAARDSVNLLGGPCYPVQLGRRDARTASFNDANANLPSPFSNFSVLLSNFQSQGLNLQDLVALSGGHSIGLARCPSFRNRIYNDSDIDPVFAASKQKNCPVTGGTFNTEPLDATTTLFDNQYFKDLIASRGLLHSDQQLFKNDSSDSDRLVRKYSTNPISFASDFSASMIKMGNLNVLTGNNGEIRMNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTGCTATTAAATCTTTTGTTGTGTATTTTGTGTTAGCTGCTGCTGCTATCATCCCAATAAATGCACAGCTGACCCCTAATTTTTATGAGAAAATGTGTCCTCAGGCATTGCCAACTA
TAAGAACAGTTGTTCGAAATGCCATAACAAATGAGACTCGCATGGGAGCATCATTACTTCGTCTACACTTCCATGACTGCTTTGTCAAT
GTAAGTGTACTTCAGATTTTAGGCCCTCAGG
GTTAATCGAGTCAATCAGTTTTTTTTAGCTGGTTAGTAGAGTTCGAATCCCGAAAGAGTTAGGAGGTTAAAAAATATTTATAACTATGGTTAATAATTAATTGATATTTGTAATTGTGAT
TATAGCTGTGATTATGTTTGTGTTTTTTGGATAGGGTTGTGATGGATCACTGCTTTTAGACGACACAGCCAACTTCGTTGGAGAGAAGACGGCCATACCCAATAATAATTCCGTCAGGGG
ATTTGATGTGATTGATGAAATAAAACAAGCAGTTAATACAGCTTGCAAAGGCAACGTGGTCTCATGTGCAGATATTGTAGCCGTTGCAGCTCGTGATTCAGTTAATCTT
GTGAGTACACA
CTTATCTCATTTTTGTATCGGTGGATGATCATATAGAATCCTAAGGAGTATTTATCTCTATGTCTGAAACTGTTGTTTATTTTGTCGACCATCTGAGTTTTGAATCTTAAGAGATGTACG
TAAAATTTTGATTTAAGCTTTGCCAATCCATCGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACTTAAAACAACTGAGTTTGTGCTTATTAATGGCAAACTTTCCTTTAGTC
TCTAGGGTTCAGTTTACCTACAAAGTTAATCTCTATCTTTTAAAACCCAAAACGTCCTTGCTATTGCTTTTATAGACGATGGACACCCAACTTTTCTAAGGNNNNNNNNNNNNNNNNNNN
NNNNNNNNCAAATAACAAGTAAAAAGGAAAAATACTTAAATTTTAACGGAAACTTGCCTATGATAAAGATGTTTTGGATAATTATATTAAAATGCAATTAATTTACTTTAAAGGTACGGT
AGCTCAAGTTTACTAAACATCTGTTTGTCAAGCATCTACTAACTTATACTTGACAGTTAATAGTTCTATTACACAAATATCTTCAGGGCTTAATCCCAAATATATGAGACGAGTATATTG
CTTTTTGTGATTTCAGTTAGGAGGTCCATGTTATCCAGTACAATTAGGAAGAAGAGATGCAAGAACTGCAAGCTTCAATGATGCAAATGCCAATCTACCTTCCCCATTTTCAAACTTCTC
TGTGCTTCTTTCAAACTTCCAATCACAAGGCTTAAATCTCCAAGACCTAGTTGCTCTCTCAGGAGGCCACAGCATTGGACTTGCTCGCTGCCCATCATTTCGGAACAGGATTTACAATGA
CTCAGATATAGATCCAGTATTTGCTGCTTCCAAGCAAAAGAATTGCCCAGTAACCGGAGGAACATTCAACACAGAACCACTTGATGCAACAACTACACTATTTGATAATCAGTACTTTAA
GGATTTGATAGCATCAAGGGGTCTCCTTCATTCTGATCAGCAACTTTTTAAAAATGATAGCAGTGATAGTGATCGGCTGGTGCGAAAGTACAGTACAAATCCAATTTCTTTTGCATCAGA
TTTTAGCGCTTCCATGATCAAGATGGGTAACTTGAACGTACTTACTGGTAATAATGGAGAAATCAGGATGAATTGCAGAAGAGTTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTGCTATTAAATCTTTTGTTGTGTATTTTGTGTTAGCTGCTGCTGCTATCATCCCAATAAATGCACAGCTGACCCCTAATTTTTATGAGAAAATGTGTCCTCAGGCATTGCCAACTA
TAAGAACAGTTGTTCGAAATGCCATAACAAATGAGACTCGCATGGGAGCATCATTACTTCGTCTACACTTCCATGACTGCTTTGTCAAT
GGTTGTGATGGATCACTGCTTTTAGACGACA
CAGCCAACTTCGTTGGAGAGAAGACGGCCATACCCAATAATAATTCCGTCAGGGGATTTGATGTGATTGATGAAATAAAACAAGCAGTTAATACAGCTTGCAAAGGCAACGTGGTCTCAT
GTGCAGATATTGTAGCCGTTGCAGCTCGTGATTCAGTTAATCTT
TTAGGAGGTCCATGTTATCCAGTACAATTAGGAAGAAGAGATGCAAGAACTGCAAGCTTCAATGATGCAAATGCCA
ATCTACCTTCCCCATTTTCAAACTTCTCTGTGCTTCTTTCAAACTTCCAATCACAAGGCTTAAATCTCCAAGACCTAGTTGCTCTCTCAGGAGGCCACAGCATTGGACTTGCTCGCTGCC
CATCATTTCGGAACAGGATTTACAATGACTCAGATATAGATCCAGTATTTGCTGCTTCCAAGCAAAAGAATTGCCCAGTAACCGGAGGAACATTCAACACAGAACCACTTGATGCAACAA
CTACACTATTTGATAATCAGTACTTTAAGGATTTGATAGCATCAAGGGGTCTCCTTCATTCTGATCAGCAACTTTTTAAAAATGATAGCAGTGATAGTGATCGGCTGGTGCGAAAGTACA
GTACAAATCCAATTTCTTTTGCATCAGATTTTAGCGCTTCCATGATCAAGATGGGTAACTTGAACGTACTTACTGGTAATAATGGAGAAATCAGGATGAATTGCAGAAGAGTTAACTAG

Retrieve as FASTA