1. Browse the Database
  2. View Redoxidase
Entry information : CclPrx88 (clementine0.9_028889m)
Entry ID 8719
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-05 (Qiang Li)
Peroxidase information: CclPrx88 (clementine0.9_028889m)
Name (synonym) CclPrx88 (clementine0.9_028889m)
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx88
start..stop		 S start..stop
CsPrx31 691 0 1..337 9..345
PpePrx77 505 0 1..330 12..341
GrPrx02 498 3.42e-179 3..330 12..337
BrPrx61-1Aa_other 496 2.12e-178 1..332 6..338
Gene structure Fichier Exons►


exon

Literature and cross-references CclPrx88 (clementine0.9_028889m)
DNA ref. Phytozome 12:   scaffold_46 (817867..820457)
Protein sequence: CclPrx88 (clementine0.9_028889m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (318)
PWM (Da):   %s   37369.77 (35446.7) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.86 (8.04) Peptide Signal:   %s   cut: 20 range:20-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MILPLVALALSLFVANADAAVSLPQPVKLEWHYYKVYNTCHDAEA
YIRHQVELFYKHDKTIAPKLLRLLYSDCFVTGCDASILLDGPNSEKTAPQNWGLGAFVLIDKIKVVLEQRCPGAVSCSDILNLATRDAVHMAGAPSYPVFTGRRDGMTSTKESVDLPSPSISWKESLACFQSKGLDVQDMVTLLGAHTMGQ
TRCRYIVDRLYNYKNTGKPDPSMNTTLLNQLRKECLPRTRKGQSDPLVYLNPETGSSYRFSESYYSRVKTHEAVLGVDQQLSNGDNNTLQIVDEFAAGFEDFRKALALSMSRMGSINVLT
GKQGEIRRNCRCTNADTNCKR

Retrieve as FASTA  
Remarks Complete sequence from genomic. Containing motif 'YSDC'.
DNA ►
Send to BLAST
CDS►
Send to BLAST