Entry information : CclPrx122 (clementine0.9_030493m)
Entry ID 8728
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx122 (clementine0.9_030493m)
Name (synonym) CclPrx122 (clementine0.9_030493m)
Class Class III peroxidase    [Orthogroup: Prx115]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx122
start..stop
S start..stop
CsPrx33 677 0 1..329 1..329
PtPrx38 356 3e-123 4..321 2..316
RcPrx60 350 4e-121 18..321 17..321
MePrx102 346 9e-120 1..312 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8558795..8558998 204 N° 2 8557407..8558192 786  
complement(join(8557407..8558192,8558795..8558998))


exon

Literature and cross-references CclPrx122 (clementine0.9_030493m)
DNA ref. Phytozome 12:   scaffold_3 (8558998..8557407)
Protein sequence: CclPrx122 (clementine0.9_030493m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (309)
PWM (Da):   %s   35902.79 (33543.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.9 (4.71) Peptide Signal:   %s   cut: 21 range:21-329
Sequence 370
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTKCSFLLFFFFILPLALAKLTPNFYSSSCPEAESIIFNVVQRRFNTDRSITGALLRMHFHDCFSGNVCDASILIDSTIRSQPEKDSGSNLTVRGYEIIDEIKNAVEQKCPSTVSCADIIALATRDAVALAGGLNYSLPTGRLDGLRSNADEVNLPGTSLSVPNVLQMFAEKGFNTTETVVILGAHTVGVVHCSFFQDRLADSDMDPAFAQELSKACEASSGSDDPMTNLDRGTPTSLDSQYYNQTLFKRGVLQIDQALALDASTHDIVAHFANDEDDFQLSFANVMVKLGSLQVLTDGQGEIRQNCRAFNRDNNANKPNRGRGLKRA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACAAAATGCTCATTTCTTCTCTTCTTCTTCTTCATTCTTCCGCTTGCGTTAGCTAAATTGACTCCAAATTTTTACAGTTCGTCTTGCCCAGAAGCAGAATCAATCATTTTCAAT
GTGGTGCAAAGAAGATTTAATACGGATAGATCCATAACTGGAGCCCTGCTTCGCATGCATTTTCATGATTGCTTTTCTGGAAAT
GTAAGCGGGAGTTTATTTACAATGAGAACNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAATTACTAACATTTTGATTGGGTATGCTTGGTTCTAGTTTAAATCAATTCTATTACAGTGCAGCCCAAATAT
CTAATGTCATTTTCAGTTAATTTGGATCTATTTTGGACCATGTCTAAATCTAATTTATGTGATATATATTTGTGTATATAATAGCCTAGGCCAAATGGATAAGTTTAAGTCTAAGCTAAT
CCGAGTTCATTGTAGGCCATTTGTGAACCCAATTTCAGTGAAATCTATACCATCTAAGATAGAAACGCACTCATGGTGTTCAAACTGTAAATTCCATGGAGTTAACCATGGATATTCGAC
TAACCAAGCCTATTTTTTCTGGATTTTAGAATGCTTACTGAGAGTTAGAATTAGGGATCATATTATTATTGAGGTGTTGTCTAAACTTTAAAAAAAAAAAAAATTGTTCTAAGAAATAAA
ACAATATGAGCTAAGTAGATTTAGAATTAGTTTTTATAAAACTATATGTTGTATTTATTACTTAAAATTAATTGTGCTCGTTTCAGGTCTGTGATGCATCAATTCTTATAGACTCAACAA
TCCGATCACAACCAGAAAAAGATTCAGGATCAAACCTAACTGTTCGAGGATACGAAATTATAGATGAAATCAAGAATGCCGTAGAGCAAAAATGCCCTTCAACCGTCTCATGTGCGGACA
TCATTGCACTCGCGACCCGCGACGCCGTGGCCCTCGCTGGAGGACTCAATTACAGTCTTCCTACTGGAAGGCTCGACGGTCTCCGATCAAACGCCGATGAAGTCAACTTGCCAGGAACAT
CACTTTCTGTTCCCAACGTATTGCAAATGTTTGCTGAGAAAGGGTTCAATACAACAGAAACCGTTGTCATACTGGGAGCTCATACCGTTGGTGTTGTGCATTGTAGCTTCTTTCAAGATA
GGCTCGCTGATTCGGACATGGATCCAGCTTTTGCTCAGGAGCTAAGCAAGGCTTGTGAGGCAAGTTCTGGTAGTGATGATCCAATGACAAATTTGGACCGCGGCACGCCAACATCTTTGG
ATAGCCAGTACTATAATCAGACTTTGTTCAAGAGAGGAGTTTTGCAGATTGATCAGGCACTTGCTTTGGATGCATCTACGCATGATATAGTGGCTCATTTTGCTAATGATGAGGATGACT
TTCAACTGAGTTTCGCCAATGTTATGGTCAAATTGGGAAGTCTCCAAGTTCTTACTGACGGTCAAGGAGAAATTAGGCAAAATTGCCGTGCTTTTAATCGGGATAATAATGCAAACAAAC
CAAATAGGGGTAGGGGACTCAAACGAGCTTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACAAAATGCTCATTTCTTCTCTTCTTCTTCTTCATTCTTCCGCTTGCGTTAGCTAAATTGACTCCAAATTTTTACAGTTCGTCTTGCCCAGAAGCAGAATCAATCATTTTCAAT
GTGGTGCAAAGAAGATTTAATACGGATAGATCCATAACTGGAGCCCTGCTTCGCATGCATTTTCATGATTGCTTTTCTGGAAAT
GTCTGTGATGCATCAATTCTTATAGACTCAACAATC
CGATCACAACCAGAAAAAGATTCAGGATCAAACCTAACTGTTCGAGGATACGAAATTATAGATGAAATCAAGAATGCCGTAGAGCAAAAATGCCCTTCAACCGTCTCATGTGCGGACATC
ATTGCACTCGCGACCCGCGACGCCGTGGCCCTCGCTGGAGGACTCAATTACAGTCTTCCTACTGGAAGGCTCGACGGTCTCCGATCAAACGCCGATGAAGTCAACTTGCCAGGAACATCA
CTTTCTGTTCCCAACGTATTGCAAATGTTTGCTGAGAAAGGGTTCAATACAACAGAAACCGTTGTCATACTGGGAGCTCATACCGTTGGTGTTGTGCATTGTAGCTTCTTTCAAGATAGG
CTCGCTGATTCGGACATGGATCCAGCTTTTGCTCAGGAGCTAAGCAAGGCTTGTGAGGCAAGTTCTGGTAGTGATGATCCAATGACAAATTTGGACCGCGGCACGCCAACATCTTTGGAT
AGCCAGTACTATAATCAGACTTTGTTCAAGAGAGGAGTTTTGCAGATTGATCAGGCACTTGCTTTGGATGCATCTACGCATGATATAGTGGCTCATTTTGCTAATGATGAGGATGACTTT
CAACTGAGTTTCGCCAATGTTATGGTCAAATTGGGAAGTCTCCAAGTTCTTACTGACGGTCAAGGAGAAATTAGGCAAAATTGCCGTGCTTTTAATCGGGATAATAATGCAAACAAACCA
AATAGGGGTAGGGGACTCAAACGAGCTTG

Retrieve as FASTA