Entry information : CclPrx[P]91 (clementine0.9_029192m)
Entry ID 8729
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: CclPrx[P]91 (clementine0.9_029192m)
Name (synonym) CclPrx[P]91 (clementine0.9_029192m)
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx[P]91
start..stop
S start..stop
CsPrx[P]69 388 1e-137 1..256 11..296
PpePrx[P]69 218 2e-71 1..256 14..263
CclPrx110 168 7e-51 28..255 103..328
CclPrx110 86 8e-20 1..59 16..73
InPrx54 165 8e-50 42..256 119..330
InPrx54 76 2e-16 14..59 29..74
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 859758..859934 177 N° 2 859487..859660 174 N° 3 859025..859441 417  
complement(join(859025..859441,859487..859660,859758..859934))


exon

Literature and cross-references CclPrx[P]91 (clementine0.9_029192m)
DNA ref. Phytozome 12:   scaffold_18 (859934..859025)
Protein sequence: CclPrx[P]91 (clementine0.9_029192m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   252 (240)
PWM (Da):   %s   27812.37 (26609.7)  
PI (pH):   %s   10.47 (10.56) Peptide Signal:   %s   cut: 13 range:13-252
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VMVLLCATSVVS*LQIGFYRYSCGPAEFTVKDDVRKAFMKDKGVAAGLWRMHFRDCFVRSGGLGYDVPAGRRDGRASKASEATTNLPSPAFNAKQLTQSFAAKGLTQEDMVVLSR*LK*IEHFKNDTRIACTSTHHRALSVQFLH*QLIQFQWKPMCAVDLKRKCPKGNNNSNLVVPMNPASPSIKTTMSVTMLIFYATEGSLLQTKLYLLTQQHRIELKTIWGNKFAAAMVRMGPIGVVTGQAGEIRANCRVINS

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Frame shift; stops in frame; 5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTAATGGTTTTGCTTTGCGCAACTAGTGTAGTGTCTTAGCTTCAAATTGGCTTTTATAGATATTCATGTGGCCCAGCCGAGTTTACTGTTAAAGATGATGTTAGAAAAGCGTTCATGAAA
GATAAAGGAGTAGCTGCCGGCCTCTGGAGAATGCATTTTCGTGATTGCTTTGTTAGG
GCAAGTATATATACATACAAATTAAAATTATCTTGTCTTCCCTCGTTTTGGTTAATTAAATTA
ATTATTTTGTTCTCTATTGATAATGTGAGTGCAGAGTGGAGGACTTGGTTATGATGTTCCCGCAGGAAGAAGAGATGGGAGAGCTTCAAAGGCCTCCGAGGCAACAACGAATTTACCTTC
GCCAGCATTTAATGCGAAACAACTCACTCAAAGCTTTGCAGCTAAGGGCTTAACACAAGAAGATATGGTTGTACTATCCCGGTAATTG
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNCGAAGTAAATTGAGCATTTTAAAAACGATACACGTATTGCATGCACGAGCACACACCATAGGGCGCTCTCAGTGCAGTTCCTTCACTGACAGCTTATACAATTTCAATG
GAAACCCATGTGTGCAGTTGACTTGAAGAGGAAGTGTCCAAAAGGTAACAATAACTCAAACTTGGTGGTACCAATGAACCCAGCTAGTCCAAGCATCAAGACAACCATGTCAGTCACCAT
GTTGATATTCTATGCAACCGAGGGCTCTTTACTTCAGACCAAACTCTACTTACTGACGCAGCAACATCGTATCGAATTAAAAACAATATGGGGAAACAAATTTGCTGCTGCTATGGTCAG
GATGGGCCCAATAGGTGTTGTAACTGGTCAAGCTGGAGAAATTCGAGCCAATTGTAGGGTTATCAACAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTAATGGTTTTGCTTTGCGCAACTAGTGTAGTGTCTTAGCTTCAAATTGGCTTTTATAGATATTCATGTGGCCCAGCCGAGTTTACTGTTAAAGATGATGTTAGAAAAGCGTTCATGAAA
GATAAAGGAGTAGCTGCCGGCCTCTGGAGAATGCATTTTCGTGATTGCTTTGTTAGG
AGTGGAGGACTTGGTTATGATGTTCCCGCAGGAAGAAGAGATGGGAGAGCTTCAAAGGCCTCC
GAGGCAACAACGAATTTACCTTCGCCAGCATTTAATGCGAAACAACTCACTCAAAGCTTTGCAGCTAAGGGCTTAACACAAGAAGATATGGTTGTACTATCCCGGTAATTG
AAGTAAATT
GAGCATTTTAAAAACGATACACGTATTGCATGCACGAGCACACACCATAGGGCGCTCTCAGTGCAGTTCCTTCACTGACAGCTTATACAATTTCAATGGAAACCCATGTGTGCAGTTGAC
TTGAAGAGGAAGTGTCCAAAAGGTAACAATAACTCAAACTTGGTGGTACCAATGAACCCAGCTAGTCCAAGCATCAAGACAACCATGTCAGTCACCATGTTGATATTCTATGCAACCGAG
GGCTCTTTACTTCAGACCAAACTCTACTTACTGACGCAGCAACATCGTATCGAATTAAAAACAATATGGGGAAACAAATTTGCTGCTGCTATGGTCAGGATGGGCCCAATAGGTGTTGTA
ACTGGTCAAGCTGGAGAAATTCGAGCCAATTGTAGGGTTATCAACAGC

Retrieve as FASTA