1. Browse the Database
  2. View Redoxidase
Entry information : CpapAPx04 (evm.model.supercontig_64.103)
Entry ID 8732
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapAPx04 (evm.model.supercontig_64.103)
Name (synonym) CpapAPx04 (evm.model.supercontig_64.103)
Class Ascorbate peroxidase     [Orthogroup: APx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapAPx04
start..stop		 S start..stop
StAPx07 252 2.18e-85 1..187 1..203
LeAPx07 246 2.88e-82 1..187 1..203
GmAPx08 243 6.74e-81 40..187 36..203
CpapAPx05 236 1.16e-79 65..187 1..144
Gene structure Fichier Exons►


exon

Literature and cross-references CpapAPx04 (evm.model.supercontig_64.103)
DNA ref. Phytozome 12:   supercontig_64 (724819..723440)
Protein sequence: CpapAPx04 (evm.model.supercontig_64.103)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188 (293)
PWM (Da):   %s   20012.44 (30269.0)  
PI (pH):   %s   10.39 (8.21) Peptide Signal:   %s   cut: 24 range:24-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSLGTVASSRLLSSSKARLCLSSSSSSPSISTLSLSSLRCLSS
SPLISRLSLNQRSFVNVSNGGFSTVATAKSAASDPDQLKSAKEDIKELLRTKFCHPILVRLGWHDAGTYNKNIEEWPQRGGANGSLRFEVELKHAANAGLVNALKLIQPIKDKRLGVQKSPMKYGRVDASG
PDQCPEEGRLPG

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (A big gap in frame due to the NNNNNNNNN in DNA sequence).
DNA ►
Send to BLAST
CDS►
Send to BLAST