1. Browse the Database
  2. View Redoxidase
Entry information : CpapAPx05 (evm.model.supercontig_64.102)
Entry ID 8733
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapAPx05 (evm.model.supercontig_64.102)
Name (synonym) CpapAPx05 (evm.model.supercontig_64.102)
Class Ascorbate peroxidase     [Orthogroup: APx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapAPx05
start..stop		 S start..stop
CclAPx02 444 2.61e-158 2..255 45..345
CsAPx05 441 2.59e-157 2..255 43..343
VvAPx06 441 1.47e-156 2..255 71..374
GmAPx08 433 1.5e-154 1..256 62..366
Gene structure Fichier Exons►


exon

Literature and cross-references CpapAPx05 (evm.model.supercontig_64.102)
DNA ref. Phytozome 12:   supercontig_64 (724473..716236)
Protein sequence: CpapAPx05 (evm.model.supercontig_64.102)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   256
PWM (Da):   %s   27610.98  
PI (pH):   %s   5.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGFSTVATAKSAASDPDQLKSAKEDIKELLRTKFCHPILVRLGWHDAGTYNKNIEEWPQRGGANGSLRFEVELKHAANAGGLVNALKLIQPIKDKYSGVTYADLFQLASATAVEEAGGPK
IxPMKYGRVDASGPDQCPEEGRLPKDGPGAPGGQSWTVQWLKFDNSYFKEIKEKRDEDLLALPTDAVLFDDPSFKVYAEKYAEDQDAFFKDYAEAHAKLSTLGAKFDPPEGIVLDDGPTK
AAPEKFVAAKYSSGKD

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (5' end is missing; A gap in frame due to the NNNN in DNA).
complement(join(716236..716241,716388..716462,717541..717645,717720..717797,717882..717956,723446..723533,723624..723725,723794..723916,724357..724473))
DNA ►
Send to BLAST
CDS►
Send to BLAST