1. Browse the Database
  2. View Redoxidase
Entry information : CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
Entry ID 8736
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2012-01-05 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-30 (Qiang Li)
Peroxidase information: CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
Name (synonym) CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapAPx[P]-R
start..stop		 S start..stop
PtAPx-R 229 1.45e-75 29..208 31..213
VvAPx-R 221 4.31e-72 64..208 55..206
RcAPx-R 219 1.49e-71 17..207 11..203
MeAPx-R 207 1.17e-66 29..208 29..211
Gene structure Fichier Exons►


exon

Literature and cross-references CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
DNA ref. Phytozome 12:   supercontig_217 (5999..4159)
Protein sequence: CpapAPx[P]-R (evm.model.supercontig_217.1 / CpapAPx[P]-R)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   208
PWM (Da):   %s   22146.63  
PI (pH):   %s   9.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLSIFKPSPLCSLRTSPTFQINFNSDSPAKPLRSSSPTVKYGARLLHACALPSPDDQSGTGKNQFCVSNRRKVLLGSTLPFLIPLERFGVQAAESGTATYSLIKEEVRKLLTKSKAAGV
LRLVFHDAGTFEMDENGGMNGSILYELDRPENSGLKKSIILNKAKTEVDAVQPVSWADVIAVAGAEAVLVCGGPTIPVLIGRLDSM

Retrieve as FASTA  
Remarks partial sequence from genomic. Incorrect prediction from Phytozome (3' end is missing).
DNA ►
Send to BLAST
CDS►
Send to BLAST