Entry information : CpapPrx12 (CpPOD6 / evm.model.supercontig_161.43)
Entry ID 8746
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-08-16 (Christophe Dunand)
Peroxidase information: CpapPrx12 (CpPOD6 / evm.model.supercontig_161.43)
Name (synonym) CpapPrx12 (CpPOD6 / evm.model.supercontig_161.43)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx12
start..stop
S start..stop
PpePrx32 476 2.42e-169 9..308 21..316
MePrx102 459 3e-162 1..308 13..316
CroPrx72 444 3.57e-156 9..308 24..323
EcamPrx48 443 4.92e-156 9..309 22..320
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8746' 'complement(join(596011..597159,597345..597509))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 597345..597509 163 N° 2 596011..597159 1147  
complement(join(596011..597159,597345..597509))


exon

Literature and cross-references CpapPrx12 (CpPOD6 / evm.model.supercontig_161.43)
DNA ref. Phytozome 12:   supercontig_161 (597509..596011)
Protein sequence: CpapPrx12 (CpPOD6 / evm.model.supercontig_161.43)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   437 (304)
PWM (Da):   %s   47310.8 (33783.8)  
PI (pH):   %s   10.56 (7.70) Peptide Signal:   %s   cut: 24 range:24-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVPLKCIRELKVGFYDATCPKAESIVNQIVQKRFTSDPSIVPALL
RMHFHDCFVR
GCDASILIDSTKEKQSEKDAGPNQTVRGFELIDEAKAALEARCPSIVSCADIITLATRDAVVLAGGPKYTIPTGRRDGLTSDINEVNLPGPQFSVSQALQSFTDKKLNLNEMVTLLGAHT
VGVSHCSFFQDRLSNFQGTGQPNPSMDPTLAAKLSKTCSSDTSSGRDPTVFLDQNTSSIFDNQFYKQIVLKKGILQIDQELAMDQSTRNIVLSFASNDVRFKQSFANAMVKMGTIDVLVG
NAGEIRQNCRVFNKVAKPSTPPPKGQQFTPPSTQPTKPPPSTPSTKPSPSIPPSKPQPSTPSAKPKPQVPPSKPPPSTPPAKPKPQSPHSKPPASIPITKPKSVKPKNKKKPSKPKDKKK
PPKPKDKKKSSKSKSSKPKHRK*

Retrieve as FASTA  
Remarks Complete sequence from genomic with a long 3' tail.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCCTCTTAAGTGTATCAGAGAGTTAAAGGTTGGGTTCTACGATGCTACGTGTCCAAAAGCGGAATCAATCGTTAACCAAATAGTGCAAAAACGATTCACGTCTGACCCGTCCATT
GTACCCGCTTTACTTCGCATGCATTTTCATGATTGCTTTGTTAGA
GTAAGTTCTCATTTGCCATCTTTTAACATGCATAAACTTATATGAAATCAAAGTATATTAAATAATAAATTGTCT
CCGTATATTTATATACCATGTCATTAAAATGGTTATATAATTAAAATTTTACTAGTAAAGAATTGAATAAATTATTTGTATGATAATAATATATGAAATTATAATTTCAGGGGGTTGTGA
TGCATCTATCTTGATTGACTCAACCAAAGAAAAGCAATCAGAAAAAGATGCAGGACCGAATCAAACTGTGCGTGGATTTGAGCTCATTGACGAGGCTAAGGCAGCCTTAGAGGCTCGATG
CCCTTCAATTGTCTCATGTGCAGACATCATAACACTTGCAACACGAGATGCTGTGGTTTTAGCTGGAGGTCCTAAATACACAATCCCGACAGGAAGACGTGACGGTTTGACTTCTGATAT
TAATGAAGTAAATTTACCAGGACCACAATTTAGTGTGTCTCAGGCATTACAATCTTTTACCGATAAAAAATTAAATCTCAATGAAATGGTGACACTATTAGGTGCACATACAGTTGGTGT
CTCTCATTGCAGTTTCTTTCAAGACCGACTTTCTAATTTCCAAGGCACTGGACAACCTAATCCTTCAATGGACCCTACTTTAGCTGCCAAGCTGAGCAAGACTTGCAGCTCTGACACCTC
ATCTGGAAGGGACCCTACTGTATTTTTGGACCAAAATACATCATCTATTTTTGATAACCAATTTTATAAGCAGATTGTTTTAAAGAAAGGGATATTGCAGATTGATCAAGAGCTTGCCAT
GGATCAATCTACTAGGAATATTGTCTTGAGTTTCGCATCAAACGACGTTAGATTCAAACAAAGTTTTGCAAATGCTATGGTGAAAATGGGAACTATTGATGTTCTTGTGGGTAATGCTGG
TGAAATTAGACAAAATTGTAGAGTTTTTAATAAAGTAGCAAAACCATCAACACCACCTCCCAAGGGTCAACAATTCACACCACCATCAACTCAACCCACCAAGCCACCGCCATCAACTCC
ATCCACCAAGCCATCACCATCAATTCCACCTTCTAAGCCACAACCATCCACCCCATCTGCTAAGCCAAAACCACAAGTTCCACCTTCTAAGCCGCCACCATCAACCCCGCCTGCCAAACC
AAAACCACAAAGCCCACATTCCAAGCCGCCAGCATCAATCCCAATCACCAAACCAAAATCAGTGAAGCCAAAGAATAAAAAGAAACCATCGAAACCAAAAGATAAGAAGAAACCACCAAA
GCCAAAAGATAAGAAAAAATCATCAAAATCAAAGTCATCTAAACCCAAACACAGAAAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCCTCTTAAGTGTATCAGAGAGTTAAAGGTTGGGTTCTACGATGCTACGTGTCCAAAAGCGGAATCAATCGTTAACCAAATAGTGCAAAAACGATTCACGTCTGACCCGTCCATT
GTACCCGCTTTACTTCGCATGCATTTTCATGATTGCTTTGTTAGA
GGTTGTGATGCATCTATCTTGATTGACTCAACCAAAGAAAAGCAATCAGAAAAAGATGCAGGACCGAATCAAACT
GTGCGTGGATTTGAGCTCATTGACGAGGCTAAGGCAGCCTTAGAGGCTCGATGCCCTTCAATTGTCTCATGTGCAGACATCATAACACTTGCAACACGAGATGCTGTGGTTTTAGCTGGA
GGTCCTAAATACACAATCCCGACAGGAAGACGTGACGGTTTGACTTCTGATATTAATGAAGTAAATTTACCAGGACCACAATTTAGTGTGTCTCAGGCATTACAATCTTTTACCGATAAA
AAATTAAATCTCAATGAAATGGTGACACTATTAGGTGCACATACAGTTGGTGTCTCTCATTGCAGTTTCTTTCAAGACCGACTTTCTAATTTCCAAGGCACTGGACAACCTAATCCTTCA
ATGGACCCTACTTTAGCTGCCAAGCTGAGCAAGACTTGCAGCTCTGACACCTCATCTGGAAGGGACCCTACTGTATTTTTGGACCAAAATACATCATCTATTTTTGATAACCAATTTTAT
AAGCAGATTGTTTTAAAGAAAGGGATATTGCAGATTGATCAAGAGCTTGCCATGGATCAATCTACTAGGAATATTGTCTTGAGTTTCGCATCAAACGACGTTAGATTCAAACAAAGTTTT
GCAAATGCTATGGTGAAAATGGGAACTATTGATGTTCTTGTGGGTAATGCTGGTGAAATTAGACAAAATTGTAGAGTTTTTAATAAAGTAGCAAAACCATCAACACCACCTCCCAAGGGT
CAACAATTCACACCACCATCAACTCAACCCACCAAGCCACCGCCATCAACTCCATCCACCAAGCCATCACCATCAATTCCACCTTCTAAGCCACAACCATCCACCCCATCTGCTAAGCCA
AAACCACAAGTTCCACCTTCTAAGCCGCCACCATCAACCCCGCCTGCCAAACCAAAACCACAAAGCCCACATTCCAAGCCGCCAGCATCAATCCCAATCACCAAACCAAAATCAGTGAAG
CCAAAGAATAAAAAGAAACCATCGAAACCAAAAGATAAGAAGAAACCACCAAAGCCAAAAGATAAGAAAAAATCATCAAAATCAAAGTCATCTAAACCCAAACACAGAAAATGA

Retrieve as FASTA