Entry information : CpapPrx41 (evm.model.supercontig_525.1)
Entry ID 8769
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapPrx41 (evm.model.supercontig_525.1)
Name (synonym) CpapPrx41 (evm.model.supercontig_525.1)
Class Class III peroxidase     [Orthogroup: Prx030]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapPrx41
start..stop
S start..stop
PtPrx08 495 4.1e-179 1..283 49..331
MePrx06 494 7.49e-179 1..284 48..331
PtrePrx03 492 1.04e-177 1..283 48..330
CsPrx36 485 5e-175 1..281 49..329
Gene structure Fichier Exons


exon

Literature and cross-references CpapPrx41 (evm.model.supercontig_525.1)
DNA ref. Phytozome 12:   supercontig_525 (2670..894)
Protein sequence: CpapPrx41 (evm.model.supercontig_525.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   283 (344)
PWM (Da):   %s   31919.04 (36418.1)  
PI (pH):   %s   6.17 (5.42) Peptide Signal:   %s   cut: 21 range:21-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
IKQEVIKLYYKHGNTAVSWVRNLFHDCVVKSCDASLLLETMNGIRSEQESERSFGMRNFKYVETIKDALEKECPLTVSCADVVALSARDGIVMLGGPRIEMKTGRKDSKESYISEVETSI
PNHNDSISSVLARFKSIGIDVEGTVALLGAHSVGRVHCVNLVRRLYPTVDPTWDPEYAEYIKGRCPTSDPDPNAVLYARNDRETPMILDNMYYKNILNHKGLLLIDQQLAFDPTTTPFVE
KMAADNGYFHDQFVRAIQLLSEINPLTNDQGEVRKNCRFVNSN*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (5' end is missing due to the NNNN in DNA sequence).
DNA
Send to BLAST
CDS
Send to BLAST