Entry information : CclAPx-R (clementine0.9_015206m)
Entry ID 8795
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclAPx-R (clementine0.9_015206m)
Name (synonym) CclAPx-R (clementine0.9_015206m)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclAPx-R
start..stop
S start..stop
CsAPx-R 684 0 1..335 1..335
PtAPx-R 471 1e-168 27..335 27..337
GhAPx-R 468 3e-167 25..334 23..333
GrAPx-R 466 2e-166 25..335 23..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 387815..387992 178 N° 2 388079..388193 115 N° 3 388900..389027 128 N° 4 389104..389174 71
N° 5 389328..389370 43 N° 6 389456..389552 97 N° 7 389780..389863 84 N° 8 390151..390272 122
N° 9 390476..390542 67 N° 10 390738..390840 103  
join(387815..387992,388079..388193,388900..389027,389104..389174,389328..389370, 389456..389552,389780..389863,390151..390272,390476..390542,390738..390840)


exon

Literature and cross-references CclAPx-R (clementine0.9_015206m)
DNA ref. Phytozome 12:   scaffold_82 (387815..390840)
Protein sequence: CclAPx-R (clementine0.9_015206m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335
PWM (Da):   %s   36424.43  
PI (pH):   %s   8.96
Sequence 376
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSSTASSLCGCSTAYYSSPLLAPKFKFKFPAKSQRPSLSTVEFRANPLTISSSLVNHRGKDGSCNSNRRRRGLLLTATLPFLLPLHEFVQDLGAKAESGMSDYLLMKEEVTKVVSKGKAASVLRLAFHDAGTFEMDDNSGGMNGSIVYELERPENAGLKKPLKILEKAKGDVNAIRPVSWADMIALGGAVAVSVCGGPNIPVPMGRLDSMEPDPEGKLPQETLDASGLKQCFQRKGFSAQELVALSGAHTLGTKGFGNPIVFDNSYYKILLEKPWQSSAGMSSMIGLPSDRALVEDDECLRWIKMYADNQNMFFEDFKNAYVKLVNSGARWRSL

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCGTTCATCAACTGCCTCCAGCCTCTGCGGCTGCTCCACCGCTTACTACTCTTCCCCTCTCCTCGCTCCCAAATTTAAATTCAAGTTTCCCGCCAAATCACAACGGCCCTCTCTCTCAA
CGGTCGAATTTCGCGCCAATCCCCTCACAATTTCTTCCTCCTTAGTCAACCACCGAG
GTTCCAGTGACTGACCATAAAACTGATTCTTGTGATTAGTTCTTGATTTATGTATTTTAACTC
TCTACATATGTTTAAATTTACAGGGAAAGATGGATCTTGCAATTCGAATAGGAGGAGGAGAGGACTGTTGCTTACGGCTACACTTCCATTTCTTCTTCCTCTCCACGAATTTGTGCAAGA
CCTGGGCGCAAAAGCTGA
GTAAGTTGATTTTTTCTTTTTTTCTTTTTTTCCAAAAGCTGTAATTGTCTGATTTTGGATGCAACTTTCATTTTGTTCATTTAAGATTGTAATTAAATCATC
TAATTGGATATAATTGAATAGCATACGTCTCTCCAATATTGTCATGTTTCATACATGAGCTTTGTTTTCATATACGATATTGCCATGCTTCAAAAGTTGGCGCACAACTTTTTTCTTTTT
CCTCACCTAATGTCGCGTATGACATGACATTGTTAGTTGTTACAATTTGCTTGGTCTTATGTGATCATTTTATCTTACCATCTCACCGATACATGGTGAATTGTTTGATTTTGATGGCCA
TATGTATGTGAAATCATTTGAGATACTATATTTGTATGCCAACTTTGTAAGTGTAGCATTACTCACATACAAGCCTTCAATAGTGCCCGTGTCCTAAAGCTTGGATAAAAGGTTTAATCC
ACATATTTTGCTAAACAGAATTACTAGTTAACAAATATAATACAGAGAGTGTGGGTTGCTAAACATTATCTTCCAAGTAAAAGTTTAGTGGCTTTTGGAGGCCAGTAGTTACAAACATAT
CCCCATTTGAGTTCTGAGGTAACTGGCCAAGTGTTAATAGTTTCTCTGTGTTGATTGACTAGATCCTGCAAATTTTTTTTCCGTTTTTCTGATTATTTTTCAATTTCCTTTACTGACACC
ACAGGTCAGGTATGAGTGACTATCTGCTTATGAAAGAAGAAGTGACTAAGGTAGTTTCAAAAGGCAAGGCTGCTAGTGTACTTCGTCTTGCATTTCATGATGCAGGGACCTTTGAAATGG
ATGATAATTCGG
GTAAGTTTTAGGATATTATGATTGGTCTTCCTCAGTTTCCTATAAAATTTATCATGTCTTCTTGTCATTAGTGCAGGTGGTATGAACGGTTCTATAGTTTATGAACTG
GAAAGACCTGAAAATGCAGGCCTGAAAAAGCCTTTGAAG
GCATGCTCTGTTTCCTTTGTTTTGTTATTGTTTTGATATATGTACTTTGTTTTCTAATTATCCATCCCTTAGATTCCTTGA
ACATAAGTCCAAACAAATTAACTCTTATGTCGCTCTACCAGCTAACCCTTTACTGGATCCATTGTTGTTTAGATTCTAGAGAAAGCAAAGGGTGACGTGAATGCAATACGGCCAGGTTTG
TCCATCTGAAATTCTGCTGTTGAATCTCTGATAGCTACGTATGCTATGGTGCTAAGATGTGTGAATCTTGCATTGTTTAGTGTCATGGGCAGATATGATCGCTTTGGGTGGAGCTGTAGC
AGTTTCAGTTTGCGGAGGTCCAAACATCCCAGTTCCTATGGGCAGACTTGATTCAAT
GTAAGTAGCTAGCTTTCCACTAAGATTAATAACTTTAAATAGAATCAATTAGGCAAACAAAGA
TTATTTACCAGAGGGATCCTCAAATGTGCAATTTCATCAATATTAAATCCTATGTGCTTCAGTGCTGATTCATTTGGAAAATTGATCAAATATCATATCATTTCATACGATAACTATCCG
AGCCTTCACTGTTTTTGCTTTTAATAAGGGATTTTTCTTCATAGGGAGCCTGATCCCGAAGGAAAACTTCCGCAAGAAACTTTGGATGCTTCTGGTTTGAAGCAATGCTTTCAAAGAAAA
GGCTTCTC
GTGAGTTTATACCAGCAGACATATTTTTTATCCATATTTTCTTCTCTAATTAAATTCAGTAATCTGTTGAGTGAATTCCTTATAAAACTAAAATCTAGCTGGCCATTTTTAT
CATTTTTTTTAAATTATGAAAATCAGTAATATGCATGCTTATAAGGCATTTAGCCACAATGTAGTTGGTACTACATTCATGTTGTTGGAAAAGCATTAACATACAGTAATTCCAATTCAG
GAACATCTGGATTGAGGAAAACCATGGCNNNNNNNNNNNNNNNNNNNNNNNNCAGAGCACAAGAGCTAGTTGCTTTATCTGGAGCCCATACTCTTGGAACCAAAGGTTTTGGAAATCCAA
TAGTTTTCGACAATTCGTACTATAAAATTCTTTTAGAGAAGCCATGGCAGTCTTCAG
GTGAATAGCCTCTCACACAGAACTCATTATGTTCTCTCCTGTGCATTTAATAAAGAATCTTAT
GTTTGTTTGAATTTCCGAATTTGGATAGTAACTTTTTGATGCAACCCTTGCAAAAAGAAAGTCTAGATGACCCAGTTATTGTTTCTTGATTAGTTTTTCTTTTCTCATCAATTGATTCTT
TTCTTTGCTTTTGCTTGTAGCTGGTATGTCAAGCATGATTGGACTTCCTTCAGATCGTGCACTTGTTGAGGATGATGAATGTTTGAGGTTTGTCATCTTCGAAGAGCCTCTTAAAACTTA
CCTGAATTCTATCAACTTCTTTTAAATGACTCTTAAGTGGTCATTAATTAGGAGATACTTTTAGAAATGAGATGTTGGGAACTGAAAACAATAAAAAATTTGTTAATAATCAACAATTAC
ATACAAAATTTTCTTATCTTTGATGCTTAAACTAATGCGCAGATGGATCAAGATGTATGCCGACAATCAGAATATGTTCTTTGAAGACTTCAAGAATGCTTACGTTAAACTAGTGAACTC
CGGAGCAAGGTGGAGAAGCTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCGTTCATCAACTGCCTCCAGCCTCTGCGGCTGCTCCACCGCTTACTACTCTTCCCCTCTCCTCGCTCCCAAATTTAAATTCAAGTTTCCCGCCAAATCACAACGGCCCTCTCTCTCAA
CGGTCGAATTTCGCGCCAATCCCCTCACAATTTCTTCCTCCTTAGTCAACCACCGAG
GGAAAGATGGATCTTGCAATTCGAATAGGAGGAGGAGAGGACTGTTGCTTACGGCTACACTTC
CATTTCTTCTTCCTCTCCACGAATTTGTGCAAGACCTGGGCGCAAAAGCTGA
GTCAGGTATGAGTGACTATCTGCTTATGAAAGAAGAAGTGACTAAGGTAGTTTCAAAAGGCAAGGCTG
CTAGTGTACTTCGTCTTGCATTTCATGATGCAGGGACCTTTGAAATGGATGATAATTCGG
GTGGTATGAACGGTTCTATAGTTTATGAACTGGAAAGACCTGAAAATGCAGGCCTGAAAA
AGCCTTTGAAG
ATTCTAGAGAAAGCAAAGGGTGACGTGAATGCAATACGGCCAGTGTCATGGGCAGATATGATCGCTTTGGGTGGAGCTGTAGCAGTTTCAGTTTGCGGAGGTCCAAACA
TCCCAGTTCCTATGGGCAGACTTGATTCAAT
GGAGCCTGATCCCGAAGGAAAACTTCCGCAAGAAACTTTGGATGCTTCTGGTTTGAAGCAATGCTTTCAAAGAAAAGGCTTCTCAGCAC
AAGAGCTAGTTGCTTTATCTGGAGCCCATACTCTTGGAACCAAAGGTTTTGGAAATCCAATAGTTTTCGACAATTCGTACTATAAAATTCTTTTAGAGAAGCCATGGCAGTCTTCAG
CTG
GTATGTCAAGCATGATTGGACTTCCTTCAGATCGTGCACTTGTTGAGGATGATGAATGTTTGAG
ATGGATCAAGATGTATGCCGACAATCAGAATATGTTCTTTGAAGACTTCAAGAATG
CTTACGTTAAACTAGTGAACTCCGGAGCAAGGTGGAGAAGCTTGTGA

Retrieve as FASTA