Entry information : SbPrx65 (Sobic.003G183300.1 [2.1] / Sb03g024460 [1.4])
Entry ID 880
Creation 2007-09-10 (Christophe Dunand)
Last sequence changes 2007-09-10 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx65 (Sobic.003G183300.1 [2.1] / Sb03g024460 [1.4])
Name (synonym) SbPrx65 (Sobic.003G183300.1 [2.1] / Sb03g024460 [1.4])
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducers Nitrogen starvation
Phosphate starvation
Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx65
start..stop
S start..stop
SofPrx02 634 0 34..343 31..340
ZmPrx61 627 0 23..343 17..336
SiPrx16 624 0 3..342 2..336
OsPrx17 590 0 14..343 3..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48728554..48728811 258 N° 2 48728909..48729100 192 N° 3 48730403..48730568 166 N° 4 48731641..48732056 416
join(48728554..48728811,48728909..48729100,48730403..48730568,48731641..48732056 )


exon

Literature and cross-references SbPrx65 (Sobic.003G183300.1 [2.1] / Sb03g024460 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_3 (48728554..48732056)
EST ref. GenBank:   CX613673.1 [5' end]   CX613765.1 [3' end]
Cluster/Prediction ref. UniGene:   Sbi.17002
Protein sequence: SbPrx65 (Sobic.003G183300.1 [2.1] / Sb03g024460 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (315)
PWM (Da):   %s   36648.58 (33897.0)  
PI (pH):   %s   8.01 (7.50) Peptide Signal:   %s   cut: 29 range:29-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKGSMMALLVPLAVALLLSGPSSLATAASGGGGPVEWGKLDPHFYDQSCPHAQHIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASLLLDSSGSIVSEKRSNPNKDSARGFEVIDEIKAALEAACPGTVSCADILALAARDSTVMTGGPGWIVPLGRRDSRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSFRQRLYNQTGNGLPDFTLDASYAATLRPRCPRSGGDQNLFFLDPITPFKFDNQYYKNILAYHGLLSSDEVLLTGSPATADLVKLYAANQDIFFQHFAQSMVKMGNISPLTGANGEIRKNCRRVNHS

Retrieve as FASTA  
Remarks Complete sequence from 30 ESTs and genomic (chromo 3, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGGGCTCAATGATGGCCTTGTTGGTCCCTCTGGCTGTTGCGCTCCTCTTGTCAGGTCCATCGTCGTTGGCAACGGCGGCATCCGGCGGCGGCGGCCCTGTGGAGTGGGGGAAG
CTGGACCCGCACTTCTACGACCAGTCGTGCCCTCACGCGCAGCACATCGTGGCGTCCATCGTGGGGAAGGCGCATTACCAGGACCCGCGCATGGCCGCCTCCCTCCTCCGCCTCCACTTC
CACGACTGCTTCGTCAAG
GTACATGCATCGTCTCTTCTCCTCCTGCTGGTGAAGTCGTCGTCGACGATGCTGCACATAGATATGCTGTATACTTAGTTGTAAGATATACTTGCAGGGCTG
CGACGCGTCGCTGCTGCTGGACAGCAGCGGGTCCATCGTGAGCGAGAAGCGGTCCAACCCCAACAAGGACTCCGCCAGGGGCTTCGAGGTCATCGACGAGATCAAGGCCGCTCTCGAGGC
TGCCTGCCCGGGAACCGTCTCCTGCGCCGACATCCTCGCGCTTGCTGCCCGCGACTCCACAGTCATG
GTATATGGTTAACCGCATCAAGCTTTCATATATCGATCAAACCTTTTCTAGTT
TTAGAGCCTTGTTTAGTTCATCTCAAAACCAAAAACTTTTCAAGATTCTCTGTCACATTGAATCTTGTGGCATATGCATGAAGTATTAAATATAGACGAAAACAAAAACTAATTACACAG
TTTGCCTGTAAATCGTAAGATAATCTTTTGAGCCTAATTAGTTTATGATTTAGATAATAATTATCAAATAAAAATAAAAGTGCTATAGTACCTAAACCAAAAAAAATTTGGAAACTAAAA
AAGGTCTCATTAGCTTCTTTGATGTGTCTTTTTTTAGTATATACTAGTCATCAAGAGTTGTTTTGTTACCTGTCCACCACATAGCTAGCTAGCTACTACATGAACAAAATCGTCTAGTCC
AGGATTTTTCTCCCTCCCATATACTGTAGTGTCGGTGAGCATAGCTAGCTTGGATGGACTTTATACAAGGAGTCACATTTCCATGTCATCGCATCGCATCTTATCTGTACCACAAGGCAC
ATGCAAAAAAACCTTTAAGTTTGTTGTGTAGTGTAGCTATATATATAGCTTTGCTGGGCCCATGCATGCACTGATATGATGTGTCCTCCATTTCTTCACTGCCTGTACATAACATACCCA
ATCGGCCGGCACTGCTGAATGCTAGCTGATGATGTGCTTTGTGTCACCCACCGTGCGTGTAAAGACGAGAGACAAAGTTCATGTGAGGGGCACGGTGCTCGGTAAAGCGGCGCCAATGTG
CTAGCTGTTTCAAAGTGATGGCATCTCATGCATGTCACGGGAGAAAGGCAGTCAAATTAGTAAAATTGAAAGGGCCTGTCAGTCTGTGTACCATCTCTACATTGTACACTCTGTAGTACG
TAGCCAATTTATAGTATGTGGTAGCTGGGTTCACATGAAAGCTAATAACAGGCTATGGGCGTGGTACAAGTAAACTAAGGACCCTTTCGGTTAGCCAGAAACAGAGCTAGGAACTATTAA
TTCCGGCTTATTAACATTATACAAGTTAGTGAACCATTCCAACTAATAATCATTTTAGGGACTCATTATTCCTGAATAACCGAACGAGCAGTAAAACAGTGCGTGTAGATGGTAGATACG
ACGAGTAGATGAGGAGGTTGTTTTTCATGAGTCTCATGACTGCCAATACTCTCGTCCCTGACTTATATATTGTGTGTGAATGAATAATTGGAACCAAAGCACCAATAATTCCAATCACCA
TAAAACTAAGCATGACCATGCATTACACCCGTGGCATATATTGATGCAGACTGGCGGGCCTGGTTGGATCGTGCCGCTGGGGCGGAGGGACTCCCGTGGCGCCAGCGTGCAGGGCTCCAA
CAACGACATCCCGGCTCCCAACAACACTCTGCCCACCATCATCACCAAGTTCAAGCTCCAGGGCCTCGACATCGTCGACCTCGTCGCACTCCTCG
GTACGTTGCCTAGCTGCTAGCTTGT
CTTCTCACGATTTCAGCCAGACGTGAGCTATGGCGATAAGACTAGGCTAATTGGTACTGAAATGTACTTATGTCGTCTTGAATTCGCACGCCACGTTGTTGAAGCTGGACGGGTGTGAGC
CAGTATAGTTCATGAATAGTGTTCTTGCTGTAGTACGTCAAAACTTGCCTAGCTATATGCAGAAATAAGGCATACAAGCAGGAGCACGTATATATCACCAACCGCATTGATATAAAAGTT
TAAACCCTACCATGTATAGGAGCTAGGAGGAAGACAACTAGTCTCATCATACACCAATTATTGCACAAAACTAAAGACATAAGAGCCACTCCAAAAGATTGTCTAAAGCTTTCCTAAAAG
CTAGAAATAGAGATTTTAATAAAAAATTATCCTCCAACAGCTTGTCTAAATGGTTATGTAAATATAGCTATCTTTTATTCTGGATTTTTCGCTAGCAAAAAACAGAAGATGAAGTGGTTC
TTTAGAGAGTGCGCATGGAGAGTGAAGCAATATAAAAAGCGATTTTTATGAAAATGGTTCTCTAAATGATGACTTAGAGAGTGAGATTTGTAAAGACTCTTGGAGATGCTCTAAGGCCTT
CTTTAGTTCACCCCAAAATCCAAAAACTTTTAAAAATTCTCCATCACATCAAATATTGCGGCACATGCATGAAGCATTAAATATAGATAAAAAATAACTAATTACACAGTTTGTCTGTAA
TTTGCGAGACGAATCTTTTAATTCTAGTTAGTCTATGGTTGGACAATAATAAATACAAACAAAAGTACTAAACTTCATCGAACTCCCTCGCAATGTAGGGATGATACCGAACAAAATTCA
GGTCTGCATGGTGCATACACATACGATTAGTTATCGCAAAGTTTCCAAACTAGCCCCCCCGGTCCGGTTAATTAATTTGCATGATTCTGCACAAGCATTTAGCATATTCATGATGATGCA
AAAGGATCACATATATAATAATTATAGTAGTAGCGGCAGAAAATCAATTAAGGATACTCTCTACTGAATTATTTGCTCTGGCTGCAGGTAGCCACACCATCGGCGACTCCCGGTGCACCA
GCTTCCGGCAGCGCCTGTACAACCAGACGGGCAACGGCCTCCCAGACTTCACCCTAGACGCGTCCTACGCGGCGACGCTACGCCCACGCTGCCCGCGCTCGGGGGGTGACCAGAACCTCT
TCTTCCTCGACCCCATCACGCCCTTTAAGTTTGACAACCAGTACTACAAGAACATCCTCGCCTACCATGGCCTCCTCAGCTCCGATGAGGTGCTCCTCACCGGCAGCCCCGCTACTGCCG
ACCTTGTCAAGCTCTATGCTGCCAACCAGGATATCTTCTTCCAGCACTTCGCGCAGTCCATGGTCAAGATGGGCAACATCTCGCCGCTCACGGGGGCCAATGGCGAGATCAGAAAGAACT
GCAGGAGGGTTAACCACAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGGGCTCAATGATGGCCTTGTTGGTCCCTCTGGCTGTTGCGCTCCTCTTGTCAGGTCCATCGTCGTTGGCAACGGCGGCATCCGGCGGCGGCGGCCCTGTGGAGTGGGGGAAG
CTGGACCCGCACTTCTACGACCAGTCGTGCCCTCACGCGCAGCACATCGTGGCGTCCATCGTGGGGAAGGCGCATTACCAGGACCCGCGCATGGCCGCCTCCCTCCTCCGCCTCCACTTC
CACGACTGCTTCGTCAAG
GGCTGCGACGCGTCGCTGCTGCTGGACAGCAGCGGGTCCATCGTGAGCGAGAAGCGGTCCAACCCCAACAAGGACTCCGCCAGGGGCTTCGAGGTCATCGAC
GAGATCAAGGCCGCTCTCGAGGCTGCCTGCCCGGGAACCGTCTCCTGCGCCGACATCCTCGCGCTTGCTGCCCGCGACTCCACAGTCATG
ACTGGCGGGCCTGGTTGGATCGTGCCGCTG
GGGCGGAGGGACTCCCGTGGCGCCAGCGTGCAGGGCTCCAACAACGACATCCCGGCTCCCAACAACACTCTGCCCACCATCATCACCAAGTTCAAGCTCCAGGGCCTCGACATCGTCGAC
CTCGTCGCACTCCTCG
GTAGCCACACCATCGGCGACTCCCGGTGCACCAGCTTCCGGCAGCGCCTGTACAACCAGACGGGCAACGGCCTCCCAGACTTCACCCTAGACGCGTCCTACGCG
GCGACGCTACGCCCACGCTGCCCGCGCTCGGGGGGTGACCAGAACCTCTTCTTCCTCGACCCCATCACGCCCTTTAAGTTTGACAACCAGTACTACAAGAACATCCTCGCCTACCATGGC
CTCCTCAGCTCCGATGAGGTGCTCCTCACCGGCAGCCCCGCTACTGCCGACCTTGTCAAGCTCTATGCTGCCAACCAGGATATCTTCTTCCAGCACTTCGCGCAGTCCATGGTCAAGATG
GGCAACATCTCGCCGCTCACGGGGGCCAATGGCGAGATCAGAAAGAACTGCAGGAGGGTTAACCACAGCTGA

Retrieve as FASTA