Entry information : CsaPrx104 (Cucsa.397150.1)
Entry ID 8803
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx104 (Cucsa.397150.1)
Name (synonym) CsaPrx104 (Cucsa.397150.1)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits No significant hits
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6019..6225 207 N° 2 5647..5838 192 N° 3 4658..5206 549  
complement(join(4658..5206,5647..5838,6019..6225))


exon

Literature and cross-references CsaPrx104 (Cucsa.397150.1)
DNA ref. Phytozome 12:   scaffold04146 (6225..4658)
Protein sequence: CsaPrx104 (Cucsa.397150.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (293)
PWM (Da):   %s   34704.96 (32171.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.66 (7.66) Peptide Signal:   %s   cut: 23 range:23-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASINVSYFFIVLFLLAFSANAELSSHFYSKSCPRLKWIVRAGMAKAVNRDKRMGASMLRMFFHDCFVNGCEASVLLDDTPTMRGEKNAFPNRNSLRGFEVIDDIKTEVEAACKETVSCADILALAARDGADLLGGPFWDVRLGRRDSRTASESEANNNLPAPSSNLSTLISMFAVKGFNANEMTAMSGAHTIGMGQCQFFRTRIYNDTNINSAFAAQRRANCPLNGGDSNLAPLDSTDIKFDNKYFIDLINQCGLFHSDQELSNGGSQDALVRTYSMNSITFRKDFENAMIKMGNLSPASGTITEIRKNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing which has been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTAACGTTTCTTATTTTTTCATTGTTCTTTTCCTTTTAGCCTTCTCAGCCAATGCTGAGCTTTCATCTCATTTTTACTCGAAAAGTTGTCCTAGACTCAAATGGATTGTT
CGTGCTGGTATGGCCAAAGCTGTAAACAGAGATAAGCGTATGGGAGCTTCGATGCTTCGCATGTTCTTCCACGATTGCTTTGTAAAT
GTACGTACGAGGATAAGAACACCATTTTCTTTG
TCTCTTCTTTTTTTTTCTTTCTGAAATATATAAGTGGAAGTTTAAACATTTATAGTAATCGTAACCAACAAACAAGACTATATAAATAGCTTAATTCAATAAGACATATATTTACAAGTG
AATTTCCTAGTTACTTTTTAAATACAGGGTTGCGAAGCTTCTGTATTGCTTGATGATACTCCAACAATGAGGGGCGAAAAAAATGCGTTCCCAAATAGGAATTCACTTAGAGGTTTCGAA
GTAATTGACGATATTAAAACTGAGGTGGAAGCTGCTTGCAAAGAAACCGTTTCATGTGCTGATATTCTTGCTCTTGCTGCTCGTGATGGCGCCGATTTG
GTAATAATTTTAATCCTTATT
ATTTTAAGTTCAAACTTAGTCTTTTTCTCAATAAAGTGTGTATATATGTAGTTGTGATCTGACGTTAAAATTGCAACTATTTTTCTGTTAAATTTGTTATAGTTTAGACAACTTGATAAG
TATATGATATTCAATCCATTATCTTATTATTTGTGTTATATCTATTTTGAAATATTTGATTTATTCTTGACCTTTTCCTGCATGTTTATTTTGCATGCAACTAATAAGTACAAAATAATA
TTGAAAAGGAAAAATATATTTTTGTATATTCTACAAAATAGAAAGAATAAAAAAATATGTATAATTTTGTCCAAAATGCCTAAACAAAACAAATTTATTATAAAACCAAAATGTTCGTAA
ATTTTTTAAAAAGTCATTTCAAACACACAGTTAACGATTTCTTTAATTTTATTATGTAGCTTGGAGGACCATTTTGGGATGTACGGCTTGGTCGAAGGGACTCGAGGACCGCGAGTGAGA
GCGAAGCAAACAACAATCTTCCAGCACCAAGCTCCAACCTCTCGACACTAATCTCAATGTTCGCTGTTAAAGGCTTTAACGCCAACGAAATGACAGCTATGTCTGGTGCTCACACCATAG
GCATGGGACAATGTCAATTCTTCCGAACTCGGATTTACAATGATACCAACATCAACAGTGCCTTCGCTGCTCAGCGACGAGCTAACTGCCCGCTTAACGGTGGTGACAGTAACTTGGCCC
CTCTTGACTCAACCGACATAAAGTTTGACAACAAATATTTCATTGACCTAATTAATCAGTGTGGCTTGTTTCATTCGGACCAAGAACTCTCCAACGGTGGTTCACAAGATGCGTTGGTTC
GAACCTATAGTATGAATTCCATTACCTTTAGAAAGGATTTTGAAAATGCAATGATCAAGATGGGGAATCTTAGTCCTGCAAGTGGAACGATTACTGAGATTAGAAAAAATTGCAGGGTCG
TGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTAACGTTTCTTATTTTTTCATTGTTCTTTTCCTTTTAGCCTTCTCAGCCAATGCTGAGCTTTCATCTCATTTTTACTCGAAAAGTTGTCCTAGACTCAAATGGATTGTT
CGTGCTGGTATGGCCAAAGCTGTAAACAGAGATAAGCGTATGGGAGCTTCGATGCTTCGCATGTTCTTCCACGATTGCTTTGTAAAT
GGTTGCGAAGCTTCTGTATTGCTTGATGATACT
CCAACAATGAGGGGCGAAAAAAATGCGTTCCCAAATAGGAATTCACTTAGAGGTTTCGAAGTAATTGACGATATTAAAACTGAGGTGGAAGCTGCTTGCAAAGAAACCGTTTCATGTGCT
GATATTCTTGCTCTTGCTGCTCGTGATGGCGCCGATTTG
CTTGGAGGACCATTTTGGGATGTACGGCTTGGTCGAAGGGACTCGAGGACCGCGAGTGAGAGCGAAGCAAACAACAATCTT
CCAGCACCAAGCTCCAACCTCTCGACACTAATCTCAATGTTCGCTGTTAAAGGCTTTAACGCCAACGAAATGACAGCTATGTCTGGTGCTCACACCATAGGCATGGGACAATGTCAATTC
TTCCGAACTCGGATTTACAATGATACCAACATCAACAGTGCCTTCGCTGCTCAGCGACGAGCTAACTGCCCGCTTAACGGTGGTGACAGTAACTTGGCCCCTCTTGACTCAACCGACATA
AAGTTTGACAACAAATATTTCATTGACCTAATTAATCAGTGTGGCTTGTTTCATTCGGACCAAGAACTCTCCAACGGTGGTTCACAAGATGCGTTGGTTCGAACCTATAGTATGAATTCC
ATTACCTTTAGAAAGGATTTTGAAAATGCAATGATCAAGATGGGGAATCTTAGTCCTGCAAGTGGAACGATTACTGAGATTAGAAAAAATTGCAGGGTCGTGAATTAA

Retrieve as FASTA