Entry information : CsaPrx13 (Cucsa.000280.1)
Entry ID 8807
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx13 (Cucsa.000280.1)
Name (synonym) CsaPrx13 (Cucsa.000280.1)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx13
start..stop
S start..stop
CsaPrx12 542 0 15..313 17..315
CsaPrx14 467 2.09e-167 12..313 23..325
InPrx73 465 1.08e-166 1..313 23..338
CclPrx07 464 2.02e-166 1..313 8..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8807' 'join(53187..53384,53506..53697,53820..53985,54082..54467)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53187..53384 196 N° 2 53506..53697 190 N° 3 53820..53985 164 N° 4 54082..54467 384
join(53187..53384,53506..53697,53820..53985,54082..54467)


exon

Literature and cross-references CsaPrx13 (Cucsa.000280.1)
DNA ref. Phytozome 12:   scaffold00009 (53187..54467)
Protein sequence: CsaPrx13 (Cucsa.000280.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (310)
PWM (Da):   %s   34218.36 (33139.5)  
PI (pH):   %s   7.41 (7.98) Peptide Signal:   %s   cut: 20 range:20-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVLTLVLALLVMFTGSSSAQLSTNFYYKTCPKLLNTVRAGIHSAV
AKEARMGASLLRLHFHDCFVN
GCDGSILLEDTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPSWKVKLGRRDSKTASFSDVTGAIPPPTSTLDTLINRFNTKGLSPRDLVALSG
AHTIGQARCLFFKNRIYNETNIDESFAEERQRTCPTNGGDDNRAPLDFKTPKLFDNYYYKNLLEKKALLRSDQVLHDGGSTDSLVELYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIR
KICSRPN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (3' end is missing which has been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTGACTTTAGTATTAGCGTTGTTGGTCATGTTTACCGGCAGCTCTTCAGCTCAGCTCTCTACTAACTTTTACTATAAGACTTGTCCCAAGCTCCTTAACACGGTTAGAGCTGGT
ATTCACTCTGCTGTGGCTAAGGAAGCACGCATGGGCGCTTCACTTCTTCGCCTTCACTTTCACGACTGTTTTGTTAAT
ATGTATACACACTTTTAATTTTTCTATTTTTTTTATTGCATT
TTCATATATATATGTATACTTTACCCTTCATTTAATTTGTTTTCATTTTATATACATGGAAACAATATTATTATCTTTCAGGGTTGTGATGGATCGATTCTTTTGGAAGATACTCCTACG
TTTACAGGAGAGCAAACAGCAGCTCCCAACAATAGATCTGTTAGAGGTTTTGACGTGATTGAGAGCATAAAGAAAAATGTAGAAAAAATTTGTCCTGGTGTTGTCTCATGTGCTGATATT
TTGACTCTTTCTGCTCGTGACTCTGTTGTAGTG
TGGTGAGTTACTAATTTGTTGATTATGCCAACTTAATTATCAAAACTTTGTACATTATGTAACTTGTTTTAGTTTGAGTATTGGATG
ATGTTGACTTACAACTTTTACCAATTAATTATTATAGCTTGGAGGGCCAAGTTGGAAGGTAAAATTAGGAAGAAGAGATTCTAAAACAGCCAGCTTCTCTGATGTCACTGGTGCTATTCC
TCCGCCAACCTCAACTCTTGACACCCTTATCAATCGATTCAACACAAAAGGCCTCTCCCCACGAGACTTGGTTGCCTTATCTG
TGGTACTATATATATCAACCATGATGTTGTTTGTAAC
ATATGATATGATCTTTTATACTAATCGTATCATACTTTATTGAATGTAATATATAATGTAGGGGCTCACACAATTGGACAAGCAAGATGTTTGTTTTTCAAGAACCGTATATACAATGAG
ACCAACATTGATGAGTCATTTGCTGAAGAGAGACAAAGGACTTGCCCAACGAATGGAGGAGATGACAATCGTGCCCCTTTAGACTTCAAAACTCCAAAGCTTTTTGACAATTACTACTAC
AAAAACCTCTTGGAGAAGAAGGCTTTGCTTCGGTCCGATCAAGTGCTCCACGACGGCGGATCCACTGATTCATTGGTTGAACTTTACAGCGATGACAGTGATACCTTTGAACATGATTTT
GTTACAGCTATGATTAAAATGGGCGACATTCAACCGCTCACTGGATCACAAGGTGAGATTCGTAAGATTTGCAGCCGACCCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTTGACTTTAGTATTAGCGTTGTTGGTCATGTTTACCGGCAGCTCTTCAGCTCAGCTCTCTACTAACTTTTACTATAAGACTTGTCCCAAGCTCCTTAACACGGTTAGAGCTGGT
ATTCACTCTGCTGTGGCTAAGGAAGCACGCATGGGCGCTTCACTTCTTCGCCTTCACTTTCACGACTGTTTTGTTAAT
GGTTGTGATGGATCGATTCTTTTGGAAGATACTCCTACGTTT
ACAGGAGAGCAAACAGCAGCTCCCAACAATAGATCTGTTAGAGGTTTTGACGTGATTGAGAGCATAAAGAAAAATGTAGAAAAAATTTGTCCTGGTGTTGTCTCATGTGCTGATATTTTG
ACTCTTTCTGCTCGTGACTCTGTTGTAGTG
CTTGGAGGGCCAAGTTGGAAGGTAAAATTAGGAAGAAGAGATTCTAAAACAGCCAGCTTCTCTGATGTCACTGGTGCTATTCCTCCGCCA
ACCTCAACTCTTGACACCCTTATCAATCGATTCAACACAAAAGGCCTCTCCCCACGAGACTTGGTTGCCTTATCTG
GGGCTCACACAATTGGACAAGCAAGATGTTTGTTTTTCAAGAAC
CGTATATACAATGAGACCAACATTGATGAGTCATTTGCTGAAGAGAGACAAAGGACTTGCCCAACGAATGGAGGAGATGACAATCGTGCCCCTTTAGACTTCAAAACTCCAAAGCTTTTT
GACAATTACTACTACAAAAACCTCTTGGAGAAGAAGGCTTTGCTTCGGTCCGATCAAGTGCTCCACGACGGCGGATCCACTGATTCATTGGTTGAACTTTACAGCGATGACAGTGATACC
TTTGAACATGATTTTGTTACAGCTATGATTAAAATGGGCGACATTCAACCGCTCACTGGATCACAAGGTGAGATTCGTAAGATTTGCAGCCGACCCAATTGA

Retrieve as FASTA