Entry information : CsaPrx14 (Cucsa.000290.1)
Entry ID 8808
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx14 (Cucsa.000290.1)
Name (synonym) CsaPrx14 (Cucsa.000290.1)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx14
start..stop
S start..stop
CsaPrx13 488 1.05e-175 23..325 12..313
CsaPrx12 481 4.51e-173 25..326 16..316
InPrx73 478 1.77e-171 3..325 17..338
CsPrx15 477 2.31e-171 14..326 8..324
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8808' 'join(80037..80267,80357..80548,80637..80805,81109..81494)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 80037..80267 229 N° 2 80357..80548 190 N° 3 80637..80805 167 N° 4 81109..81494 384
join(80037..80267,80357..80548,80637..80805,81109..81494)


exon

Literature and cross-references CsaPrx14 (Cucsa.000290.1)
DNA ref. Phytozome 12:   scaffold00009 (80037..81494)
Protein sequence: CsaPrx14 (Cucsa.000290.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (295)
PWM (Da):   %s   35382.1 (31944.2) Transmb domain:   %s   i12-34o
PI (pH):   %s   9.12 (8.93) Peptide Signal:   %s   cut: 31 range:31-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTTHTPKHVVPLVLVLQLTFLLMSTSFAQLSVSFYSNTCPKLLSVIRSGVQSAITKEARIGASLLRLHFHDCFVNGCDGSILLDDTATFRGEQTAPPNNRSVRGFDVIKAIKSNIEKV
CPGVVSCADILTLAARDSVNILGGPTWEVKLGRRDSKTASFSAASSGIIPPPTSTLSNLINRFNVVGLSAKDMVALSGAHTIGQARCVTFRNRIYNESNIDVSFAKLRQRSCPRSGGDDN
LAPLDFTTPKFFDNNYYKNLLNNKGLLHSDQVLHNGGSTDSLVQQYSQNDKTFDTDFVTAMIKMGDIQPLTGSQGEIRKVCNRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTACTACTCACACTCCAAAACATGTGGTGCCTTTGGTTCTAGTTTTGCAGCTAACCTTCCTTTTGATGAGCACCTCTTTCGCTCAACTATCCGTTTCTTTCTACTCCAACACT
TGCCCTAAGCTCCTCTCTGTAATCCGCTCTGGTGTTCAATCTGCCATCACCAAGGAAGCCCGTATTGGCGCTTCTCTCCTTCGTCTTCACTTCCATGACTGCTTTGTTAAC
ACGTATATA
TATAATGTTATTACGTTTATTGTAATTTTTTATTAATCAATAACTTGTTGTCTCTAAATTAGCATTTGTACATTTCTTTTAGGGATGCGATGGATCAATCCTTTTAGATGATACTGCAAC
TTTTAGAGGAGAACAAACAGCGCCTCCAAACAATAGGTCTGTTAGAGGCTTTGATGTCATAAAAGCCATCAAGAGTAACATTGAAAAAGTTTGTCCTGGTGTGGTCTCATGTGCTGATAT
TTTGACTCTTGCTGCACGTGATTCTGTTAACATT
TTGTAAGTTTGTTTTTAATACGACTTTTCAAGATTTGCACCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNGTTGGGAGGGCCAACATGGGAAGTGAAATTAGGAAGAAGAGATTCAAAAACAGCCAGCTTCTCTGCTGCTAGTAGTGGCATCATCCCTCCCCCTACTTCAACCCTTTCCAACCTCAT
CAATCGATTCAATGTTGTAGGACTCTCCGCCAAAGACATGGTTGCCTTGTCTG
TGGTATTCTTTTCCGTTTCATCTATTCTCATCATTCATTTCATTTCATTTAAACTGAAGGTCTATCG
ATTTGAAAACAACTTTTTAAGTACTTAAAAAAGTGATTCATAATCAAACATAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTCTAAACTTTAATGTCTAGAGTTTTTCGTTAC
ACATGAAATTCAAATTTGTCAAAGCTTGTCGGATACAAAACTAAAAGTTTCAAAAACCTATATGTTAACACATTTAAAAATTCCAGTGACTAAATAGAAAATAATGTTATGCATGTAGGT
GCACACACGATAGGCCAAGCAAGGTGTGTAACCTTTAGAAATCGCATATACAACGAGAGCAACATAGACGTCTCATTCGCGAAGCTAAGACAAAGGAGTTGTCCAAGAAGTGGAGGAGAT
GACAATCTTGCCCCTCTAGATTTTACAACCCCAAAGTTTTTTGATAACAATTACTACAAGAACCTTTTGAATAATAAGGGGTTGCTCCACTCTGACCAGGTCCTCCACAATGGCGGATCC
ACCGATTCTTTGGTCCAACAGTATAGTCAAAATGATAAGACTTTTGACACTGATTTTGTGACAGCAATGATTAAAATGGGAGACATTCAACCGCTCACTGGATCACAGGGCGAGATCAGA
AAAGTCTGCAACAGACCAAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTACTACTCACACTCCAAAACATGTGGTGCCTTTGGTTCTAGTTTTGCAGCTAACCTTCCTTTTGATGAGCACCTCTTTCGCTCAACTATCCGTTTCTTTCTACTCCAACACT
TGCCCTAAGCTCCTCTCTGTAATCCGCTCTGGTGTTCAATCTGCCATCACCAAGGAAGCCCGTATTGGCGCTTCTCTCCTTCGTCTTCACTTCCATGACTGCTTTGTTAAC
GGATGCGAT
GGATCAATCCTTTTAGATGATACTGCAACTTTTAGAGGAGAACAAACAGCGCCTCCAAACAATAGGTCTGTTAGAGGCTTTGATGTCATAAAAGCCATCAAGAGTAACATTGAAAAAGTT
TGTCCTGGTGTGGTCTCATGTGCTGATATTTTGACTCTTGCTGCACGTGATTCTGTTAACATT
TTGGGAGGGCCAACATGGGAAGTGAAATTAGGAAGAAGAGATTCAAAAACAGCCAGC
TTCTCTGCTGCTAGTAGTGGCATCATCCCTCCCCCTACTTCAACCCTTTCCAACCTCATCAATCGATTCAATGTTGTAGGACTCTCCGCCAAAGACATGGTTGCCTTGTCTG
GTGCACAC
ACGATAGGCCAAGCAAGGTGTGTAACCTTTAGAAATCGCATATACAACGAGAGCAACATAGACGTCTCATTCGCGAAGCTAAGACAAAGGAGTTGTCCAAGAAGTGGAGGAGATGACAAT
CTTGCCCCTCTAGATTTTACAACCCCAAAGTTTTTTGATAACAATTACTACAAGAACCTTTTGAATAATAAGGGGTTGCTCCACTCTGACCAGGTCCTCCACAATGGCGGATCCACCGAT
TCTTTGGTCCAACAGTATAGTCAAAATGATAAGACTTTTGACACTGATTTTGTGACAGCAATGATTAAAATGGGAGACATTCAACCGCTCACTGGATCACAGGGCGAGATCAGAAAAGTC
TGCAACAGACCAAACTGA

Retrieve as FASTA