Entry information : CsaPrx18 (Cucsa.043880.1)
Entry ID 8810
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx18 (Cucsa.043880.1)
Name (synonym) CsaPrx18 (Cucsa.043880.1)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx18
start..stop
S start..stop
PtPrx44 499 3.1e-180 12..318 11..317
EcamPrx158 493 8.33e-178 1..318 1..316
MePrx02 492 1.65e-177 6..319 7..317
EglPrx158 491 3.82e-177 1..318 1..316
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8810' 'complement(join(511239..511633,511750..511912,512013..512201,512296..512505))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 512296..512505 208 N° 2 512013..512201 187 N° 3 511750..511912 161 N° 4 511239..511633 393
complement(join(511239..511633,511750..511912,512013..512201,512296..512505))


exon

Literature and cross-references CsaPrx18 (Cucsa.043880.1)
DNA ref. Phytozome 12:   scaffold00542 (512505..511239)
Protein sequence: CsaPrx18 (Cucsa.043880.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (294)
PWM (Da):   %s   34477.41 (31886.0)  
PI (pH):   %s   9.07 (9.07) Peptide Signal:   %s   cut: 25 range:25-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASFAVLFSHFAVLLLSVLSLGSSLSLDYYEKTCPGADFIVTKAVRAAAYKDKTVPAALLRMHFHDCFIRGCDASILLNSVGNNVAEKDGPPNLSLHSFFVIDNAKKELESYCPGVVSCA
DILALAARDAVVLSGGPTWDVPKGRKDGRISKASETIQLPSPSFNISQLQQSFSQRGLSLDDLVALSGGHTLGFAHCSSFQGRIRNFSPASNVDPEMNPSFAASLRNMCPVNNNAKNAGS
NMDTSPTTFDNNYYRLILQKKGLFSSDQALLKFPKTNNLLYKFASSKEAFNRAFVNSMIKMSSITGGQEIRKNCRAVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCTTTGCTGTGCTATTCTCACACTTTGCAGTTCTTTTGCTGTCTGTTTTGTCCTTGGGAAGTTCATTGAGCTTAGACTACTACGAGAAGACATGCCCTGGTGCCGACTTCATC
GTTACTAAAGCTGTCAGGGCTGCAGCTTATAAAGACAAGACTGTTCCTGCTGCACTTCTCCGGATGCACTTTCATGACTGCTTTATTAGG
GTATTCTATTCTCTTTAGAATTCTCAGCAT
GTTTAAACTTCTCTTCTGTGTTTGACAAAACTAAACTGGTTTTGTTTGATTACTTGGTTTGAAGGGGGTTGTGATGCATCCATACTGCTGAATTCAGTAGGGAACAACGTGGCAGAGAAA
GATGGGCCACCTAATTTGTCTTTGCATTCGTTTTTTGTGATTGACAATGCGAAGAAAGAACTGGAATCTTATTGTCCTGGTGTTGTCTCTTGTGCTGATATCTTGGCTCTGGCTGCAAGA
GATGCAGTTGTGCTT
GTAAGAAAACATGCATATAATTCAACTTGCAAACAAGATGGTTTGAAATTATGAAGTCCAAAACATTCTCTCTAAATGGGTATAATTTTGTGTCCTGCAGTCTCT
GGAGGTCCAACATGGGATGTTCCTAAAGGAAGAAAGGATGGAAGGATATCAAAGGCTAGTGAAACAATACAATTGCCATCTCCAAGCTTCAACATATCTCAGCTGCAACAGAGCTTCTCA
CAAAGGGGATTATCCCTGGACGACTTAGTAGCTCTTTCAG
GTAAACCACACACAATAGGCAACAAGATGATAAAATATTGTTAAAGAAAGAAGGAAAGCTAAACTATTAAAGATATTCTT
ATAAAGCGTAAGCATTGCCAATATTATGTAATGCAGGGGGGGACACACCTTAGGATTTGCCCATTGCTCATCCTTCCAAGGTAGAATCCGCAACTTCAGTCCGGCCAGCAACGTTGACCC
TGAAATGAACCCATCCTTTGCAGCAAGTCTACGAAACATGTGCCCAGTAAACAACAACGCAAAAAATGCTGGGTCTAACATGGATACTTCTCCAACCACATTTGACAACAATTACTACAG
ATTGATACTCCAAAAGAAGGGACTGTTTTCTTCTGATCAAGCTCTGCTCAAATTTCCTAAGACCAACAATCTTCTTTATAAGTTCGCAAGCTCAAAGGAAGCTTTTAACCGTGCATTTGT
TAATTCTATGATCAAGATGAGTAGCATCACTGGAGGTCAGGAGATCAGGAAGAATTGTAGGGCAGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCTTTGCTGTGCTATTCTCACACTTTGCAGTTCTTTTGCTGTCTGTTTTGTCCTTGGGAAGTTCATTGAGCTTAGACTACTACGAGAAGACATGCCCTGGTGCCGACTTCATC
GTTACTAAAGCTGTCAGGGCTGCAGCTTATAAAGACAAGACTGTTCCTGCTGCACTTCTCCGGATGCACTTTCATGACTGCTTTATTAGG
GGTTGTGATGCATCCATACTGCTGAATTCA
GTAGGGAACAACGTGGCAGAGAAAGATGGGCCACCTAATTTGTCTTTGCATTCGTTTTTTGTGATTGACAATGCGAAGAAAGAACTGGAATCTTATTGTCCTGGTGTTGTCTCTTGTGCT
GATATCTTGGCTCTGGCTGCAAGAGATGCAGTTGTGCTT
TCTGGAGGTCCAACATGGGATGTTCCTAAAGGAAGAAAGGATGGAAGGATATCAAAGGCTAGTGAAACAATACAATTGCCA
TCTCCAAGCTTCAACATATCTCAGCTGCAACAGAGCTTCTCACAAAGGGGATTATCCCTGGACGACTTAGTAGCTCTTTCAG
GGGGACACACCTTAGGATTTGCCCATTGCTCATCCTTC
CAAGGTAGAATCCGCAACTTCAGTCCGGCCAGCAACGTTGACCCTGAAATGAACCCATCCTTTGCAGCAAGTCTACGAAACATGTGCCCAGTAAACAACAACGCAAAAAATGCTGGGTCT
AACATGGATACTTCTCCAACCACATTTGACAACAATTACTACAGATTGATACTCCAAAAGAAGGGACTGTTTTCTTCTGATCAAGCTCTGCTCAAATTTCCTAAGACCAACAATCTTCTT
TATAAGTTCGCAAGCTCAAAGGAAGCTTTTAACCGTGCATTTGTTAATTCTATGATCAAGATGAGTAGCATCACTGGAGGTCAGGAGATCAGGAAGAATTGTAGGGCAGTGAACTAA

Retrieve as FASTA