Entry information : CsaPrx21 (Cucsa.072840.1)
Entry ID 8811
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-11 (Christophe Dunand)
Peroxidase information: CsaPrx21 (Cucsa.072840.1)
Name (synonym) CsaPrx21 (Cucsa.072840.1)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx21
start..stop
S start..stop
MePrx24 513 0 14..328 11..326
ThasPrx28 506 0 9..327 51..371
NnPrx23 498 1.22e-179 14..328 11..327
PtPrx27 497 3.31e-179 17..328 14..327
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8811' 'join(393160..393378,393482..393673,393817..393979,394094..394503)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 393160..393378 217 N° 2 393482..393673 190 N° 3 393817..393979 161 N° 4 394094..394503 408
join(393160..393378,393482..393673,393817..393979,394094..394503)


exon

Literature and cross-references CsaPrx21 (Cucsa.072840.1)
DNA ref. Phytozome 12:   scaffold00765 (393160..394503)
Protein sequence: CsaPrx21 (Cucsa.072840.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (294)
PWM (Da):   %s   35972.39 (30605.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.01 (7.70) Peptide Signal:   %s   cut: 32 range:32-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRMQRLTFLVLATIVGLLSLIGSTQAQLKLGFYAKSCPHAEKIVL
DFVHQHIHNAPSLAATFIRMHFHDCFVR
GCDASVLINSTSNNQAERDSAPNQTLRGFDFIDRVKSLLEDECPGVVSCADVLSLIARDTIVATGGPYWEVPTGRRDGVISRSREALNNIPPPFGNLSTLQRLFSNQGLDLKDLVLLSGA
HTIGIAHCQSFSNRLYNFTGVGDQDPSLDPRYAANLKANKCRTPTANNKVEMDPGSRNTFDLSYYSLLLKRRGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAASMEKMGRIKVKT
GTEGEIRRRCGVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAATGCAGAGGCTTACTTTTTTGGTGTTGGCCACTATAGTTGGTCTTCTAAGCCTGATAGGCTCCACTCAAGCTCAGCTAAAGCTTGGTTTCTATGCCAAAAGCTGCCCACACGCT
GAGAAGATTGTGCTAGATTTCGTTCACCAGCATATCCACAATGCCCCTTCATTGGCAGCAACTTTCATTAGAATGCACTTCCACGATTGCTTTGTCAGG
GGGTATTGTTTCTTTTCGTTT
CCATCTTCATGAAAATCCTTAATCCTTACAACTCCTATATGCAACTGACATTTACTTCTCTCTGTTTGATGTGTTGCTGAACAGGGTTGTGATGCATCTGTGCTTATAAACTCCACCTCA
AACAACCAAGCTGAGAGGGATTCTGCACCAAATCAAACACTCAGAGGCTTTGACTTCATTGATAGAGTCAAAAGCTTACTTGAAGATGAATGCCCTGGAGTGGTCTCTTGCGCAGATGTT
CTTTCCTTGATTGCAAGAGATACCATTGTAGCCACA
CAGTAAGAATCCACCCAGCCGACCAAATGCCCTTTTAACTTTTCCAGTGTTCGATGCTGTTTGTACTCTCTTTTCTTATCGAAA
AATGAAAAAGACAAGCAACACACTTTCTCTATTTGATGGTTGTATTCATTTCAATATGCAGGGAGGTCCTTACTGGGAAGTTCCAACTGGCCGAAGAGATGGAGTGATCTCAAGATCAAG
AGAAGCCTTAAATAACATTCCTCCTCCATTTGGAAACTTGTCCACGCTCCAAAGACTTTTCTCAAACCAAGGCCTTGATCTAAAAGACTTGGTGTTACTATCTG
TGGTAAGTTCCATATA
ATTTAAAAAGTAACCAAAAAAAAAGAAAAAGTAACCCCATTAACACTAATTCTTCACTCAGTACTTTTCTGAAACACGTTGCATCCAATCATGATTTCAGGCGCTCACACAATCGGCATA
GCACACTGCCAATCATTCAGCAATCGACTCTACAATTTCACCGGGGTAGGAGACCAAGATCCCTCTCTAGACCCAAGATACGCTGCTAATCTGAAGGCTAACAAATGCCGAACTCCCACC
GCCAACAACAAAGTGGAAATGGACCCAGGAAGTCGTAACACTTTTGACCTTAGCTACTATTCTCTTCTACTAAAAAGGAGGGGCCTCTTCGAATCCGATGCTGCTCTTACAACAGACGCA
ACTACATTGGGTTTAGTTCAGAAACTGGTAGAAGGACCCATTGAAGAATTCTTCGCTGAATTTGCAGCATCCATGGAGAAAATGGGTCGGATTAAAGTGAAAACTGGAACTGAAGGTGAA
ATCAGAAGGAGATGCGGTGTGGTGAATAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAATGCAGAGGCTTACTTTTTTGGTGTTGGCCACTATAGTTGGTCTTCTAAGCCTGATAGGCTCCACTCAAGCTCAGCTAAAGCTTGGTTTCTATGCCAAAAGCTGCCCACACGCT
GAGAAGATTGTGCTAGATTTCGTTCACCAGCATATCCACAATGCCCCTTCATTGGCAGCAACTTTCATTAGAATGCACTTCCACGATTGCTTTGTCAGG
GGTTGTGATGCATCTGTGCTT
ATAAACTCCACCTCAAACAACCAAGCTGAGAGGGATTCTGCACCAAATCAAACACTCAGAGGCTTTGACTTCATTGATAGAGTCAAAAGCTTACTTGAAGATGAATGCCCTGGAGTGGTC
TCTTGCGCAGATGTTCTTTCCTTGATTGCAAGAGATACCATTGTAGCCACA
GGAGGTCCTTACTGGGAAGTTCCAACTGGCCGAAGAGATGGAGTGATCTCAAGATCAAGAGAAGCCTTA
AATAACATTCCTCCTCCATTTGGAAACTTGTCCACGCTCCAAAGACTTTTCTCAAACCAAGGCCTTGATCTAAAAGACTTGGTGTTACTATCTG
GCGCTCACACAATCGGCATAGCACAC
TGCCAATCATTCAGCAATCGACTCTACAATTTCACCGGGGTAGGAGACCAAGATCCCTCTCTAGACCCAAGATACGCTGCTAATCTGAAGGCTAACAAATGCCGAACTCCCACCGCCAAC
AACAAAGTGGAAATGGACCCAGGAAGTCGTAACACTTTTGACCTTAGCTACTATTCTCTTCTACTAAAAAGGAGGGGCCTCTTCGAATCCGATGCTGCTCTTACAACAGACGCAACTACA
TTGGGTTTAGTTCAGAAACTGGTAGAAGGACCCATTGAAGAATTCTTCGCTGAATTTGCAGCATCCATGGAGAAAATGGGTCGGATTAAAGTGAAAACTGGAACTGAAGGTGAAATCAGA
AGGAGATGCGGTGTGGTGAATAGT

Retrieve as FASTA