Entry information : CsaPrx28 ( Cucsa.093730)
Entry ID 8817
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2014-02-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-03-31 (Christophe Dunand)
Peroxidase information: CsaPrx28 ( Cucsa.093730)
Name (synonym) CsaPrx28 ( Cucsa.093730)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx28
start..stop
S start..stop
RcPrx30 514 0 11..327 9..325
PpePrx27 508 0 7..323 3..319
PpePrx25 504 0 7..325 3..319
GmPrx48 504 0 3..323 4..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50825..51034 210 N° 2 51129..51320 192 N° 3 52761..53342 582  
join(50825..51034,51129..51320,52761..53342)


exon

Literature and cross-references CsaPrx28 ( Cucsa.093730)
DNA ref. Phytozome 12:   scaffold00919 (50825..53352)
Protein sequence: CsaPrx28 ( Cucsa.093730)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (305)
PWM (Da):   %s   36501.16 (33886.8)  
PI (pH):   %s   6.05 (5.77) Peptide Signal:   %s   cut: 23 range:23-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANTFFPLFLFFLLFHFPSLSPAKLQLNFYSNSCPQAEAIVRSVMHKAFIREPRSVASVMRFQFHDCFVNGCDASMLLDDTPTMLGEKLSLANINSLRSYEVVDEVKETLEKVCPGIVSCADIIIMASRDAVFLTGGPDWPVELGRLDSLTASQEDSDQIMPSPRANATSLIDLFSKYNLSVKDLVALSGSHSIGKGRCFSIMFRLYNQSGTGRPDPAIEPRFREELFKRCPHGVDENVTLNLDSTPYVFDNQYFKDLVGGRGLLNSDETLYTFGETRKYVRFFSKNQSAFFDAFVEGMSKMGDLQSGRPGEVRRNCRVVNGQSVII*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAAGTTTTT AAACCTAAGT CGTTGCTTGC AAATTGTATC AGAAATTCTC TCAAAACTTT TTGTCATTCT AATGAATTCT CACAAACCAA TCTCAACCTA GAGGATATAA AGGTCTCCGA  CGAGTAATGT CTCAAATTTG GTGATTTGTA GATTCAGAGA CGTCGTCAAG AGTAAATTCC TCTATTCTAT AGTTCTCTAA TCTATAATTT GTTTAAACAT ATGTTTAACC TTAGTTAAAA  TTATAAGAAA ATTTGTTTAT GCAATTGTTT AACAATTTAC AATAATTTTA AGTTTCAAAT TAAATTAATG TAAGATCTCC CATTGCTTTC GTTTCGTTCC TTCAATAAAA CAAGTACATA  GATTAACTTA CTCTATTTAG ACGAACCAAC GCATTCACCA AAACATTACT ACAAGACTAC ATGCATCCCT CCCAACAACT ATCTAACCTC AAGTAACACC CCACTCCAAA ACTCTGAATT  CCTCCATCAT TGCTCAAATT CACAATCTCT CCCCCAATAA CACACACACA CACCACATCT CAAAGAAAGA AAGAAAACAA AATCCTTTTG AAAGAAACAA GAAACCACCC AGGCCTAAGC  CTTTTTCCAA CAGAAACCCA AATTAGGACC TTCATTCATT GGAGGGAGGA AGAAATTGCC TATTTAAAAG TTTTCTTTAC ACAAACTAAA CCATATGTCA ACATTTGGAA TCATATGTAT  CCTAAACTCG TGGTTCCCAC CTTCCATTTC CCTTACAAAA ATATTAACTT AACATTTTAT AATAAAGCTT AATCAATCCC ATAATTACTT TACAATTTTA GAAAAGTAAA TGGAATCTCC  ATAATGCCCC CATTCACCAC TCATACTTCG ACACGCGTTC ATTATTAATT TATTTGACAA AAATATTTAG AAAAAAACAG TCAAAGTAAA TATTACCAAA TATGACAAAT AATTAGTAAT  ATCAAATGGT TATAAGATTA TAAAAAACTA TCAATTTTTA ATTTGCTACT TTCATAAAAG GAATGAAGCA TTAATGTGTC AAATAGGAAA TAGGAAATAG TTTTATTTAT ATTTTAAATT  TCAATTAGTC AATTTATCGT TACTCATTTT CAAACAAATG TCTATGTTTA TTTATTAATT TAGAAGGATT ATGAATGACA ATTTCAAATT TACTTTTAAG TGATGAAATA TAGTGAAATT  TAATTTAAAC ATCACTCTAA CTATTTTAAA TTTATTAACC TACGTAAATA CAAAAATAAG TATTTAGTGA AAATTAATAA ATATTTAGTG AAAATTTGAG GTTAAGAACG TAGATATTCA  ACCAAATTGA AACAAAATAT AAATGTAAAA ATAAAAGTCT AATATTTTAG TGGAGTTTTT CAAAAAATAT AAAAAAGTAC AACGAGGAAA TAGTAAAAAA TAGTAAATTC GACGAAATAT  TTTCCAAAAT TTTGCTATAA CTTATAAATA TTTTAATTTA TTTTACTATT TTAAAAAATG ACCAAACTAT TTACTATGCA ATTTAAATAG ATTGTCCATT GCCATTTTTT TTTTATAATT  CATCTATTTT AATTTTATTA AAAACTAAAT TAAAATCAAA ATATGAAAAA GTTGGTAGAA AAGTTGTAAC CTCAATCTTA GGAATTAAAT AAAAGGGACA TTGCAAAAAT AGCAAAAAAA  AAAATTTATG ATAATAAAAT TCACTTCATT ACATTTTTAA ATTATAAAAA TAATTTTAAA AGTACATAAA TTTATTTTTA GTCCTCCAAT AGCTCTATAT GCAGGTTCTA ATATTCCTAA  TTTTGTCATA GCTAAAGTTG ATGCATGAAA GGAGGCAAGG ACCAAAGAAA TGGCAATTAT TGGCCATCCT TAGCCCATAT AGCCTTTGTC GTCTATAACT TGCCATTGCC ATTGCTATTG 
TGCTCTGCTA TAAGAAAGCT TTCCAACCTA AACAACTTTT TTAGTGAATA CTGAATGAAT TCTATTCCCA ACGCGCAACC A 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAATACCTTCTTCCCTCTCTTCCTCTTCTTCCTCCTCTTCCACTTTCCATCCCTTTCTCCGGCCAAACTCCAGCTCAATTTCTACTCCAACTCATGCCCTCAGGCCGAAGCCATA
GTCCGTTCTGTGATGCACAAAGCTTTCATCAGAGAACCTCGTAGTGTCGCCTCCGTTATGCGTTTCCAGTTTCACGATTGCTTTGTTAAT
GTAATTGATCCCCCCAACTGTTCGTTCTTT
TGGATTTTGCTTTTTTTCTTTACCTGTTTGGCTTCTGAATCGGCGTTTCCTTTGTCTAATTCAGGGCTGTGATGCTTCTATGTTGCTAGATGATACGCCGACGATGCTTGGAGAGAAACT
CTCTCTTGCTAACATTAATTCGCTTAGATCTTACGAAGTCGTTGATGAAGTGAAAGAGACTTTGGAGAAGGTTTGTCCTGGCATTGTTTCTTGTGCAGATATCATAATTATGGCATCCAG
AGACGCTGTCTTTTTG
GTGAGTACTTCCGTTTCTTCTACCTCTGTTTTTTGTGCTATGAAATTCTTATTGGAGCCTGAGATTTGTTTTTCTTGATGTTTATCTTCTTTGCTTCGTTTTTC
ACTCTCAATCCTTCTCCTAAAATCCACAAATCGAAATTCCGAAAACACAAGAAAGAGGAACGAATCAACCAACACTGCCTTTCAATTTAACATTTCAGTTCCATTAATTCCACTTAATTG
TTTGAAATTTTTGCTACCAAACAACAGTCCAAATTTGAGTGAACTCCATTTTTTAAAACGATTTAATATAGAATTTGAATACTTCGTGATAATCGTTGGATTTTAATTTAAAAAGAAATA
TTTAGGATAAGAAGTAGAACATTGAATTGAAAAGTAAGAATTTATAGAATCAGAGAGTATTTCTACCGTATAAGAAAGAGCGGAGTAATGTGTATATATGTATTATAAAAATCGAACTAT
TGTTATATCTTTTACCCTACAACAAAAGAAAGTTGTATGAGACATAGAAAATCAGACCGACATGATGTGACACCATTTTTCAACTTAAAACACACGAGAGAATATTTTTAGCATATGATA
TTTTTTTATCTTCGAAAGAGAGAAATCAACTTTCATGCATGTTTCCTAATTCAGTCGATCTAAGATGGGGTAGAATTATTATTTTCATTTTTAAATTGGGTTCATTTTCTCTTAATTCCA
TGTTCATAGTTTTCTCATTCTTAGTAAAAAATACTCCTAAAATATAGACAATCAAACATCGTCCTAAACAATGGTTGTGAAATGATGTATATAAGCTTAAGTTTAAAAAATCAAAATTCA
AAGAGTTACCAAATGAGGTGTAAGTGATGAGAAAAGTATCACAACTATTTGTATGGTTCATAAGTTGTTTGAAAAGAGTTAAGTGGGATTGATACCTTGTACTGAATTAGTAAGGTACCC
AATAATAATAGTAGCTTGTTAATAAAGCAGAGTTGGACAGTAACCCTTGCATAAGCAAGTAACTTCCAATGGTTTAAAAGCTCCACCAACAATCCTGCCAAAAATTCATAACAAACTGGT
CCATCCCCATCCTCCCACCCCAACTACTTTTCCAAATGTCATCCTCTTGCTCATTTTGTCAAGAATTCACGTCCAAAGAAATCAAAATATAACCACTTTTATTATTGATTGTTTTTAACC
CTATCGAATCTAAATTCATTAAGCTAAAATAAACATAACTCAATCGATTCACATTTGAATTATCAACTTAGAATGTTCGATCTTTCACTTATATGTCATAAACAAGAAAGAAATAAATTC
ATTAAGTCTGAAGGAATATATTCAATCTGAAAACAAAAATAAGATAATAGGATGAAGTTATGAGCTATTTCTCTAATTTATAATTAATTTTGAGATGAAATTCACATTTTTATGAACATA
ACTTGTATTTATTCAGACAGGCGGCCCTGATTGGCCAGTAGAACTGGGACGGCTGGACAGTTTAACAGCAAGCCAAGAGGACTCGGACCAAATCATGCCAAGTCCAAGAGCCAATGCAAC
TTCTCTCATTGACCTTTTCAGCAAATACAACCTCTCCGTCAAAGATTTGGTAGCTCTTTCAGGTTCGCACTCAATTGGCAAAGGCCGATGTTTCTCCATCATGTTTCGACTCTACAACCA
ATCCGGCACAGGACGACCAGACCCAGCAATCGAGCCTAGGTTCAGAGAAGAGCTCTTCAAGCGATGCCCTCATGGCGTGGATGAAAATGTGACACTCAACCTTGATTCCACACCTTACGT
TTTTGACAATCAGTACTTCAAGGACTTGGTTGGTGGGAGGGGTTTGTTGAATTCTGATGAAACTCTTTACACATTCGGTGAAACTAGAAAGTACGTGAGGTTCTTTAGCAAAAATCAAAG
TGCATTTTTTGATGCATTTGTGGAAGGTATGTCGAAGATGGGCGACTTGCAATCTGGCCGGCCGGGGGAAGTGAGAAGGAACTGTCGGGTAGTGAATGGCCAATCTGTGATCATATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAATACCTTCTTCCCTCTCTTCCTCTTCTTCCTCCTCTTCCACTTTCCATCCCTTTCTCCGGCCAAACTCCAGCTCAATTTCTACTCCAACTCATGCCCTCAGGCCGAAGCCATA
GTCCGTTCTGTGATGCACAAAGCTTTCATCAGAGAACCTCGTAGTGTCGCCTCCGTTATGCGTTTCCAGTTTCACGATTGCTTTGTTAAT
GGCTGTGATGCTTCTATGTTGCTAGATGAT
ACGCCGACGATGCTTGGAGAGAAACTCTCTCTTGCTAACATTAATTCGCTTAGATCTTACGAAGTCGTTGATGAAGTGAAAGAGACTTTGGAGAAGGTTTGTCCTGGCATTGTTTCTTGT
GCAGATATCATAATTATGGCATCCAGAGACGCTGTCTTTTTG
ACAGGCGGCCCTGATTGGCCAGTAGAACTGGGACGGCTGGACAGTTTAACAGCAAGCCAAGAGGACTCGGACCAAATC
ATGCCAAGTCCAAGAGCCAATGCAACTTCTCTCATTGACCTTTTCAGCAAATACAACCTCTCCGTCAAAGATTTGGTAGCTCTTTCAGGTTCGCACTCAATTGGCAAAGGCCGATGTTTC
TCCATCATGTTTCGACTCTACAACCAATCCGGCACAGGACGACCAGACCCAGCAATCGAGCCTAGGTTCAGAGAAGAGCTCTTCAAGCGATGCCCTCATGGCGTGGATGAAAATGTGACA
CTCAACCTTGATTCCACACCTTACGTTTTTGACAATCAGTACTTCAAGGACTTGGTTGGTGGGAGGGGTTTGTTGAATTCTGATGAAACTCTTTACACATTCGGTGAAACTAGAAAGTAC
GTGAGGTTCTTTAGCAAAAATCAAAGTGCATTTTTTGATGCATTTGTGGAAGGTATGTCGAAGATGGGCGACTTGCAATCTGGCCGGCCGGGGGAAGTGAGAAGGAACTGTCGGGTAGTG
AATGGCCAATCTGTGATCATATAA

Retrieve as FASTA