Entry information : CsaPrx37 (Cucsa.128450.1)
Entry ID 8824
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CsaPrx37 (Cucsa.128450.1)
Name (synonym) CsaPrx37 (Cucsa.128450.1)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx37
start..stop
S start..stop
CsaPrx38 520 0 1..337 1..339
CsaPrx39 486 2.97e-174 2..337 3..338
VvPrx27 460 2.75e-164 18..337 17..332
RcPrx04 456 9.76e-163 12..337 3..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8824' 'join(466093..466329,466859..467632)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 466093..466329 235 N° 2 466859..467632 772  
join(466093..466329,466859..467632)


exon

Literature and cross-references CsaPrx37 (Cucsa.128450.1)
DNA ref. Phytozome 12:   scaffold01024 (466093..467632)
Protein sequence: CsaPrx37 (Cucsa.128450.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (295)
PWM (Da):   %s   36771.32 (32342.4)  
PI (pH):   %s   8.42 (9.43) Peptide Signal:   %s   cut: 27 range:27-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSQKFKLLSKLLSNCIIFFFLFHSTLASKTLKVGFYKSSCPH
AETIIKNAVNQAISQNPGIAAGLIRMHFHDCFVR
GCEASVLLKSTPNNPSEREHIANFPSLRGFEVIDEAKAKIEAICPNTVSCADILAFAARDSACRVGGINYAVPAGRRDGRISIKEEANSLPGPSFNAEQLTESFGKRGFSSEEMVTLSGA
HSIGVAHCPTFSNRLYSFNTTHPQDPSMDPLYAAYLKTKCPPPSGNNDGSDEPTAALEFFSPHRLDNWYYIELKNHRGLLSSDQTLLSSSSTKEMVLHNAKHGHQWAAKFGKAMVKMGFV
DVLTGSQGEIRRHCSFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTTCTTCTCAAAAGTTCAAACTTCTCTCAAAGCTACTCTCTAATTGCATCATCTTCTTCTTCCTCTTTCACTCCACTTTGGCTTCTAAAACCCTAAAAGTAGGGTTCTATAAA
TCATCGTGTCCTCACGCTGAGACCATTATCAAGAATGCTGTAAATCAAGCCATCTCTCAAAACCCCGGCATTGCTGCGGGTCTTATTCGAATGCACTTCCATGATTGTTTCGTTAGA
GAG
TAAGTTTCAAAAGCTTTTTTGATTTTTTATTGTGTTTTTCTTTTCCAAACGATTTGAATACAATTCATCAAAGTTTAATTTGATTTCTAACTTTTTAAGTGTTTTCTCTTTTGTCCAATC
AAACACTTTGATAAGGGTAGGATGAATTATTTGGGTGTTTTTTCGAAATAAATATTATGTTATTTAGTAGTAGATTTTGAATTTTAGGAGTTATTATGTTTATAAAGAAAAAGACAGGGG
TATACTCAAATAATTATTATTAGTTAATATTCTAATTATAGTTTGTTGTTAATAATGTATAATTTAAACGTATTAATATTATGCAGTATGGGTTAACAAACTTAAAGTCGATGGTTTATA
GNNNNNNNNNNNNNNNNNNNNNNNCAATAACCCACTTTTCAAATGAATTTTACGAGTCAAAATTGAATAAACGAGGAAAATATTTCATACTTAGATCCCTTTAATACTACATTTCTCTCT
CATTAGTATTAATCTAACATTCAAATTTTCTAATATGCAATTATTCAGGGTTGTGAAGCTTCCGTGTTGCTGAAGTCCACACCCAACAACCCATCAGAGAGAGAACATATAGCAAACTTC
CCAAGCTTACGAGGTTTCGAGGTTATCGACGAAGCCAAGGCCAAAATCGAGGCTATTTGCCCGAACACCGTTTCTTGTGCCGACATTCTCGCCTTCGCCGCCCGGGACAGCGCATGCAGA
GTTGGAGGTATCAACTATGCAGTACCAGCCGGTCGTCGTGATGGTCGCATCTCAATAAAGGAAGAAGCAAACAGTCTCCCTGGTCCCTCTTTCAATGCCGAGCAGCTCACAGAGAGTTTC
GGCAAGCGGGGTTTCTCATCAGAGGAGATGGTGACTCTTTCCGGTGCGCACTCCATTGGAGTAGCTCATTGTCCTACCTTCTCCAATAGACTTTATTCCTTCAACACAACTCATCCACAA
GACCCTTCCATGGACCCTTTATATGCTGCATACTTGAAGACCAAATGCCCACCCCCGAGTGGCAATAACGATGGAAGCGACGAACCAACAGCGGCGCTCGAGTTCTTCTCTCCACATCGT
TTGGATAATTGGTACTATATCGAGTTGAAGAACCACCGTGGGCTGCTGAGCTCGGATCAAACATTGTTGAGTAGCTCTTCCACTAAAGAAATGGTGTTGCATAATGCTAAGCATGGCCAT
CAATGGGCTGCTAAATTTGGAAAGGCAATGGTTAAAATGGGTTTCGTTGATGTTCTAACAGGATCACAGGGTGAGATTAGACGCCATTGCAGCTTTGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTTCTTCTCAAAAGTTCAAACTTCTCTCAAAGCTACTCTCTAATTGCATCATCTTCTTCTTCCTCTTTCACTCCACTTTGGCTTCTAAAACCCTAAAAGTAGGGTTCTATAAA
TCATCGTGTCCTCACGCTGAGACCATTATCAAGAATGCTGTAAATCAAGCCATCTCTCAAAACCCCGGCATTGCTGCGGGTCTTATTCGAATGCACTTCCATGATTGTTTCGTTAGA
GGT
TGTGAAGCTTCCGTGTTGCTGAAGTCCACACCCAACAACCCATCAGAGAGAGAACATATAGCAAACTTCCCAAGCTTACGAGGTTTCGAGGTTATCGACGAAGCCAAGGCCAAAATCGAG
GCTATTTGCCCGAACACCGTTTCTTGTGCCGACATTCTCGCCTTCGCCGCCCGGGACAGCGCATGCAGAGTTGGAGGTATCAACTATGCAGTACCAGCCGGTCGTCGTGATGGTCGCATC
TCAATAAAGGAAGAAGCAAACAGTCTCCCTGGTCCCTCTTTCAATGCCGAGCAGCTCACAGAGAGTTTCGGCAAGCGGGGTTTCTCATCAGAGGAGATGGTGACTCTTTCCGGTGCGCAC
TCCATTGGAGTAGCTCATTGTCCTACCTTCTCCAATAGACTTTATTCCTTCAACACAACTCATCCACAAGACCCTTCCATGGACCCTTTATATGCTGCATACTTGAAGACCAAATGCCCA
CCCCCGAGTGGCAATAACGATGGAAGCGACGAACCAACAGCGGCGCTCGAGTTCTTCTCTCCACATCGTTTGGATAATTGGTACTATATCGAGTTGAAGAACCACCGTGGGCTGCTGAGC
TCGGATCAAACATTGTTGAGTAGCTCTTCCACTAAAGAAATGGTGTTGCATAATGCTAAGCATGGCCATCAATGGGCTGCTAAATTTGGAAAGGCAATGGTTAAAATGGGTTTCGTTGAT
GTTCTAACAGGATCACAGGGTGAGATTAGACGCCATTGCAGCTTTGTTAAT

Retrieve as FASTA