Entry information : CsaPrx38 (Cucsa.128460.1)
Entry ID 8825
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CsaPrx38 (Cucsa.128460.1)
Name (synonym) CsaPrx38 (Cucsa.128460.1)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx38
start..stop
S start..stop
CsaPrx37 520 0 1..339 1..337
CsaPrx39 451 9.18e-161 14..339 11..338
MePrx89 447 6.27e-159 14..339 11..334
MePrx80 444 7.19e-158 18..339 15..334
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8825' 'join(471379..471618,471931..472129,472255..472832)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 471379..471618 238 N° 2 471931..472129 197 N° 3 472255..472832 576  
join(471379..471618,471931..472129,472255..472832)


exon

Literature and cross-references CsaPrx38 (Cucsa.128460.1)
DNA ref. Phytozome 12:   scaffold01024 (471379..472832)
Protein sequence: CsaPrx38 (Cucsa.128460.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339
PWM (Da):   %s   36759.41 Transmb domain:   %s   i13-35o
PI (pH):   %s   7.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANSSPPLKLFQALFSKLLCIIFFFSLSTFATTSLRVGFYSSSCPDAEAIVEDAVDKAVSRNPGIAAGLIRMHFHDCFVRGCDASVLLESTPGNPSEKYHVANFPTLRGFEVIDEAKAKI
EAVCPNTVSCADVLAFAARDSANKVG
GINYAVPAGRRDGFISRKEDANALPGFTFHAERLASEFGKRGLSVEEMVTLSGAHSIGIAHCPTFVGRLYSFNTTHAQDPSLDPSYADYLKSKC
PQPSSSGDDGSQQPDVDLDFSTPHRLDNRYYIELKNHRGLLISDQTLLSSSLTSKMVLRNAHYGSKWATKFGKAMVKMGKIDVLTGSKGEIRRQCSFV

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAATTCTTCTCCTCCCCTTAAGTTATTCCAAGCACTTTTCTCCAAGCTCTTATGCATCATCTTCTTCTTTTCCCTATCTACTTTTGCTACTACAAGCCTCAGAGTAGGTTTCTAT
AGTTCATCTTGTCCCGATGCTGAGGCCATTGTTGAAGATGCGGTAGACAAAGCCGTCTCTAGAAACCCCGGTATCGCTGCAGGTCTCATTAGAATGCACTTCCACGACTGCTTTGTTAGG
GGGTATGTTTCATTCAAAGTTTTTCCTTTGATAAAACCTTATAAATTATAATAATACTGTATGATAAAATAAATTTTAACTTTTAGAACTACGTGAAAAATTCGTTCCACAAAGACAAAA
TTCATGTAATTTAACCTCACTTTTAATATAACACACGCATTTGTCAAAAAACTTGAATTTAGATATCCATCTTTGCACTTTCTAATTTAGCAAATTTTGTATATTTTCTTTCTCTTTCTT
GAACCCACCCAATTATTATTAAGGAAAATAAAAAATTGACTTCTATATCTCTCTTTTGTTTTGTAATTTTTCAGGGATGTGATGCTTCTGTGCTTCTAGAATCGACTCCTGGAAATCCAT
CTGAGAAATATCATGTTGCAAACTTTCCAACCTTACGAGGTTTTGAGGTTATTGATGAAGCCAAGGCGAAAATTGAAGCTGTTTGTCCTAACACTGTGTCATGCGCCGACGTTCTTGCTT
TCGCTGCCCGCGATAGCGCCAACAAAGTTGGAG
AGGTACGGTTAATTATCCCTAACTGATTAAATTCAAAAGCTTAAACTTTGATATATTACAATAGTTTTTTTTGAAAATTTGATACAT
TACAATACATTTAAATCTTCTCTACTCATATTTGTACCAGGTATTAACTATGCCGTACCAGCAGGCCGTCGTGATGGATTCATCTCGAGAAAGGAAGATGCTAACGCTCTCCCTGGTTTT
ACTTTCCATGCCGAGAGGCTGGCTAGTGAGTTCGGAAAACGAGGGTTGTCAGTGGAGGAGATGGTGACTCTTTCCGGTGCCCATTCCATAGGAATAGCTCATTGCCCTACCTTTGTTGGC
AGGCTATATTCCTTCAATACAACTCATGCACAAGACCCTTCCTTGGACCCCTCATATGCTGATTACTTGAAGAGCAAATGCCCACAGCCAAGTAGCTCTGGTGATGACGGGAGTCAGCAG
CCAGACGTGGATCTTGATTTTTCAACCCCGCATCGTTTGGATAACCGTTACTACATCGAGCTAAAGAACCACCGTGGGCTGCTGATCTCCGATCAGACATTGTTGAGCAGTTCATTGACT
TCAAAAATGGTGTTGAGAAATGCCCATTATGGGTCCAAATGGGCAACCAAGTTTGGGAAGGCAATGGTTAAAATGGGCAAAATTGATGTCCTTACAGGATCCAAGGGAGAGATCAGACGC
CAATGCAGCTTTGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAATTCTTCTCCTCCCCTTAAGTTATTCCAAGCACTTTTCTCCAAGCTCTTATGCATCATCTTCTTCTTTTCCCTATCTACTTTTGCTACTACAAGCCTCAGAGTAGGTTTCTAT
AGTTCATCTTGTCCCGATGCTGAGGCCATTGTTGAAGATGCGGTAGACAAAGCCGTCTCTAGAAACCCCGGTATCGCTGCAGGTCTCATTAGAATGCACTTCCACGACTGCTTTGTTAGG
GGATGTGATGCTTCTGTGCTTCTAGAATCGACTCCTGGAAATCCATCTGAGAAATATCATGTTGCAAACTTTCCAACCTTACGAGGTTTTGAGGTTATTGATGAAGCCAAGGCGAAAATT
GAAGCTGTTTGTCCTAACACTGTGTCATGCGCCGACGTTCTTGCTTTCGCTGCCCGCGATAGCGCCAACAAAGTTGGAG
GTATTAACTATGCCGTACCAGCAGGCCGTCGTGATGGATTC
ATCTCGAGAAAGGAAGATGCTAACGCTCTCCCTGGTTTTACTTTCCATGCCGAGAGGCTGGCTAGTGAGTTCGGAAAACGAGGGTTGTCAGTGGAGGAGATGGTGACTCTTTCCGGTGCC
CATTCCATAGGAATAGCTCATTGCCCTACCTTTGTTGGCAGGCTATATTCCTTCAATACAACTCATGCACAAGACCCTTCCTTGGACCCCTCATATGCTGATTACTTGAAGAGCAAATGC
CCACAGCCAAGTAGCTCTGGTGATGACGGGAGTCAGCAGCCAGACGTGGATCTTGATTTTTCAACCCCGCATCGTTTGGATAACCGTTACTACATCGAGCTAAAGAACCACCGTGGGCTG
CTGATCTCCGATCAGACATTGTTGAGCAGTTCATTGACTTCAAAAATGGTGTTGAGAAATGCCCATTATGGGTCCAAATGGGCAACCAAGTTTGGGAAGGCAATGGTTAAAATGGGCAAA
ATTGATGTCCTTACAGGATCCAAGGGAGAGATCAGACGCCAATGCAGCTTTGTGAAT

Retrieve as FASTA