Entry information : CsaPrx39 (Cucsa.128470.1)
Entry ID 8826
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CsaPrx39 (Cucsa.128470.1)
Name (synonym) CsaPrx39 (Cucsa.128470.1)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx39
start..stop
S start..stop
CsaPrx37 486 2.98e-174 3..338 2..337
CsaPrx38 451 9.16e-161 11..338 14..339
GmPrx332 443 1.24e-157 11..338 10..324
GmPrx192 443 1.24e-157 11..338 10..324
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8826' 'join(487913..488146,488399..488597,489017..489597)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 487913..488146 232 N° 2 488399..488597 197 N° 3 489017..489597 579  
join(487913..488146,488399..488597,489017..489597)


exon

Literature and cross-references CsaPrx39 (Cucsa.128470.1)
DNA ref. Phytozome 12:   scaffold01024 (487913..489597)
Protein sequence: CsaPrx39 (Cucsa.128470.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (145)
PWM (Da):   %s   36430.6 (15650.8) Transmb domain:   %s   i9-31o
PI (pH):   %s   9.69 (5.10) Peptide Signal:   %s   cut: 22 range:22-166
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSSQKFNILSKLSTVIFFLYLSTFASAATLKVGFYRSSCPNA
EAIVKKVVNKAISLNPGAAAGLIRLHFHDCFIR
GCEGSVLLKSTPGHPTERDHPSNFPSLQGFEIIDEAKAYLESACPNTVSCADILAFAARDSARKVGGINYAVPAGRRDGRISIKEEASRLPSPTFNIEQLTQNFAERGLSKTDMVTLSGA
HSIGAARCLTFSNRLYSFNATHNQDPSMNPKYAAYLKTKCPPLTSNVGGQNAQPLEAALDFTTPNRLDNQYYIGLTKHQGLLSSDQILLSSPSTSKLALVYAKYGSIWASNFKKSMVKMG
SIGVLTGSQGEIRRQCSFV

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCTTCTCAAAAGTTCAATATTCTTTCAAAGCTTTCAACCGTTATCTTCTTCCTCTATCTCTCCACTTTTGCTTCTGCTGCAACCCTAAAAGTTGGTTTTTATCGTTCA
TCTTGTCCCAATGCTGAGGCTATCGTTAAGAAAGTTGTAAACAAAGCCATCTCTCTGAACCCCGGTGCGGCGGCCGGCCTCATTCGATTGCACTTCCATGATTGTTTTATTAGG
GGGTAT
GTCTCAAAGTTTCCTTAAAACACTTTAGTACTTAAAAGATAAAAAAGATTGTCCGCATTTTGAGTTGCATTCAATTGCATTGTTACACAGTTAGTCGCATGNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNGCCGTGTTGATGAAGTGGAATGCAAAGAGAGATGTAGGTATAGTTCAGAATGTATTAAAGTATTTTTCACTTGGGTTGATTTCTAAGTCTCTCTTTCTTCACATTTA
AATTTAAGGGTTGTGAAGGTTCTGTGCTGTTGAAATCCACTCCTGGACATCCAACTGAGAGAGATCATCCTTCAAACTTTCCAAGTTTACAAGGTTTCGAGATTATTGATGAAGCCAAGG
CCTATCTTGAGTCTGCTTGTCCCAACACTGTCTCTTGCGCTGACATCCTTGCCTTTGCTGCTCGTGATAGCGCTCGTAAAGTTGGAG
AGGTATATCATCATCATTTGATAATTAATCATC
TTCTTTATTGGATTTTAGTTTTTAAAAATTGTGATTAGCACACGAATGTAATTTTTTAACAANNNNNNNNNNNNNNNNNNNNNNCTCGCAAGAAAGTTAATAAAAGAAAAAAAGGAAAAT
GATAGATGAGAGAGCATAGGGTTGATGAGCTTAATTTTAAAATTTTATGAACCAAATCTGATTATGGCCTTCGTGATCTTTAAATTTATCTATCTTTTAGTTAATATTTTNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNTAAATTACTGTCCGCAGGAATTAATTATGCAGTACCAGCTGGTCGTCGTGATGGACGCATCTCAATAAAAGAAGAGGCCAGTCGTCTTCCTTCTCCCACCTTCAACATT
GAACAACTCACCCAAAATTTTGCTGAGCGAGGGCTATCGAAGACAGATATGGTAACTCTTTCTGGCGCCCACTCGATCGGAGCAGCTCGATGCCTCACCTTCTCCAATAGGCTTTATTCC
TTCAACGCAACCCACAATCAAGACCCTTCCATGAACCCAAAATACGCAGCTTACTTGAAGACCAAATGCCCACCACTAACTAGCAACGTTGGAGGCCAAAATGCTCAGCCGCTCGAGGCG
GCCCTTGACTTTACGACCCCGAATCGTCTAGATAACCAATACTACATCGGCTTGACTAAGCATCAAGGACTATTGAGCTCTGATCAAATATTGTTGAGTAGCCCTTCCACATCAAAATTA
GCGTTGGTTTATGCAAAGTATGGCTCGATATGGGCCTCCAATTTTAAGAAGTCTATGGTTAAAATGGGTTCCATTGGTGTCCTCACTGGATCACAAGGCGAGATTAGGCGTCAGTGCAGC
TTTGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCTTCTCAAAAGTTCAATATTCTTTCAAAGCTTTCAACCGTTATCTTCTTCCTCTATCTCTCCACTTTTGCTTCTGCTGCAACCCTAAAAGTTGGTTTTTATCGTTCA
TCTTGTCCCAATGCTGAGGCTATCGTTAAGAAAGTTGTAAACAAAGCCATCTCTCTGAACCCCGGTGCGGCGGCCGGCCTCATTCGATTGCACTTCCATGATTGTTTTATTAGG
GGTTGT
GAAGGTTCTGTGCTGTTGAAATCCACTCCTGGACATCCAACTGAGAGAGATCATCCTTCAAACTTTCCAAGTTTACAAGGTTTCGAGATTATTGATGAAGCCAAGGCCTATCTTGAGTCT
GCTTGTCCCAACACTGTCTCTTGCGCTGACATCCTTGCCTTTGCTGCTCGTGATAGCGCTCGTAAAGTTGGAG
GAATTAATTATGCAGTACCAGCTGGTCGTCGTGATGGACGCATCTCA
ATAAAAGAAGAGGCCAGTCGTCTTCCTTCTCCCACCTTCAACATTGAACAACTCACCCAAAATTTTGCTGAGCGAGGGCTATCGAAGACAGATATGGTAACTCTTTCTGGCGCCCACTCG
ATCGGAGCAGCTCGATGCCTCACCTTCTCCAATAGGCTTTATTCCTTCAACGCAACCCACAATCAAGACCCTTCCATGAACCCAAAATACGCAGCTTACTTGAAGACCAAATGCCCACCA
CTAACTAGCAACGTTGGAGGCCAAAATGCTCAGCCGCTCGAGGCGGCCCTTGACTTTACGACCCCGAATCGTCTAGATAACCAATACTACATCGGCTTGACTAAGCATCAAGGACTATTG
AGCTCTGATCAAATATTGTTGAGTAGCCCTTCCACATCAAAATTAGCGTTGGTTTATGCAAAGTATGGCTCGATATGGGCCTCCAATTTTAAGAAGTCTATGGTTAAAATGGGTTCCATT
GGTGTCCTCACTGGATCACAAGGCGAGATTAGGCGTCAGTGCAGCTTTGTGAAT

Retrieve as FASTA