Entry information : CsaPrx40 (Cucsa.128480.1)
Entry ID 8827
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CsaPrx40 (Cucsa.128480.1)
Name (synonym) CsaPrx40 (Cucsa.128480.1)
Class Class III peroxidase    [Orthogroup: Prx222]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx40
start..stop
S start..stop
CsaPrx41 388 7.52e-136 24..338 13..328
EguPrx150 340 4.06e-117 29..338 1..309
EferPrx28 340 1.06e-116 16..338 15..340
EferPrx27 340 1.06e-116 16..338 15..340
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8827' 'complement(join(492055..492819,493668..493916))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 493668..493916 247 N° 2 492055..492819 763  
complement(join(492055..492819,493668..493916))


exon

Literature and cross-references CsaPrx40 (Cucsa.128480.1)
DNA ref. Phytozome 12:   scaffold01024 (493916..492055)
Protein sequence: CsaPrx40 (Cucsa.128480.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338
PWM (Da):   %s   36699.43  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEIRKCKMQSELSGELAKIVALLMVGLVMISKGHSQELKVGFYSETCPLAETIVRTTVAKAVSQNPGMAAGIIRMHFHDCIVLGCDASILLDKTPENPDTEKGVNVGNPLLRGFEIIDDA
KFEIETRCPQTVSCADILAFAARDSVATLGQFTYDVPSGRRDSLVSHGANVSDNIPFPTTDIGFLAQHFEERGLSLRDMVALSGAHSIGRTGCPEFTDRLFSSNGTEITDPSLDPTFAAT
LRQKCPFGSGFDKTADLDNVTPNHLDIQFFENLKNKMGVLSSDQAIATDPLTAAIVSRYQGNRAIWMRDFSAAMVKMGKLLVLTGTQGEIRKECHFRN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCAGAAAGTGCAAGATGCAAAGTGAATTGAGTGGAGAATTAGCAAAGATTGTGGCTTTGTTAATGGTGGGCTTAGTTATGATATCTAAAGGTCACTCACAAGAGTTAAAAGTC
GGGTTTTATAGTGAAACATGTCCTTTGGCTGAAACTATTGTGAGAACCACAGTGGCAAAAGCTGTTTCTCAAAACCCTGGAATGGCTGCTGGCATTATTCGAATGCATTTCCATGACTGT
ATTGTTCTG
GTAAGCTCATTTCATCCATCTTTTAAAAACTTCATCATTGTTCATTTAGGTCAATGATCGATTCTAATTAACGTTTAGATAGTGGAATAAATTAATGAACGTGTCATGTTA
ATATCTTGTTAATTAACGTGTTGGTACCAAAGGTCGAATGATTTATACGTTTATAATTTAACCTAATATTAAGTTTCATTGACATTTTCGGATTATTCTCGACATACTCTCTCAATATTT
GTTTTTGTATTATATGTTTGTTTGGAGTTCATGAACTTTTTATACCGTATTAAATTTTTTACGTGAAATCCTAGAATGTTGTGGTTCTTAAATTATTTTGTTTATACATGTGTACTTTGT
AGGTCTTTAATATTTTAGTTCCTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAAGTCCTAAACGTCTAATTTCGATTAAGNNNNNNNNNNNNNNNNNNNNNNGGCTTAAATGATA
AGCTAGGTGTATGTATCACATTATGATAATTTTTGTATGACGTAAATTTCAATGAGAAATTAGACCACTTTGAGATAATTTTAATCTCTTCCAAATTTAAATTTCTTATAAGACAATATA
TTGTGGAATTTAACAAAGGAAAAAATAAGGTATAATTGAAAAATAACATTAAAACATAAAAGATTAAACTGAACATTCAACCATGCATATACGCTATCGGTATCCATCAATAATTTTAAA
TAACCTTGAAATGGGAAAAAGCACTAACACCATATAAACAAAAACATAACTTTCTAGCCATTATTGTGTATGGTTGGTTTAGGCTTTTGTTACACATTTATATTTCATATATTACAGCCT
TCAAACAAATTTGACAGGGGGCTGTGATGCATCAATACTCCTTGATAAAACACCAGAAAATCCTGATACTGAGAAAGGTGTAAATGTCGGTAACCCATTATTACGAGGCTTCGAAATAAT
CGACGATGCGAAGTTCGAAATCGAAACTCGATGTCCGCAAACTGTTTCTTGCGCGGACATCCTAGCCTTTGCAGCTCGGGACAGCGTCGCGACACTCGGTCAGTTCACCTACGACGTCCC
AAGCGGTCGTCGTGACTCACTGGTCTCTCATGGGGCAAATGTATCTGACAACATCCCTTTTCCGACAACTGATATTGGATTTCTTGCACAACATTTTGAAGAACGAGGCTTGTCGCTTAG
AGACATGGTGGCGCTTTCTGGAGCACATTCTATTGGAAGGACGGGTTGTCCAGAATTTACCGATCGACTTTTCTCGAGCAATGGAACAGAAATAACCGACCCAAGTTTGGACCCAACCTT
TGCAGCAACTTTGAGACAGAAGTGTCCGTTTGGTAGCGGGTTTGATAAGACGGCAGATTTGGACAATGTGACGCCAAATCATCTCGATATTCAGTTCTTTGAGAATTTGAAGAACAAGAT
GGGAGTTTTGTCGTCAGATCAAGCAATTGCTACTGACCCTCTTACAGCAGCGATAGTGAGCAGATACCAAGGGAATAGAGCAATATGGATGAGGGATTTCTCAGCGGCCATGGTGAAGAT
GGGGAAGCTACTAGTTTTGACTGGAACTCAAGGGGAGATTAGAAAGGAGTGTCATTTTAGGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCAGAAAGTGCAAGATGCAAAGTGAATTGAGTGGAGAATTAGCAAAGATTGTGGCTTTGTTAATGGTGGGCTTAGTTATGATATCTAAAGGTCACTCACAAGAGTTAAAAGTC
GGGTTTTATAGTGAAACATGTCCTTTGGCTGAAACTATTGTGAGAACCACAGTGGCAAAAGCTGTTTCTCAAAACCCTGGAATGGCTGCTGGCATTATTCGAATGCATTTCCATGACTGT
ATTGTTCTG
GGCTGTGATGCATCAATACTCCTTGATAAAACACCAGAAAATCCTGATACTGAGAAAGGTGTAAATGTCGGTAACCCATTATTACGAGGCTTCGAAATAATCGACGATGCG
AAGTTCGAAATCGAAACTCGATGTCCGCAAACTGTTTCTTGCGCGGACATCCTAGCCTTTGCAGCTCGGGACAGCGTCGCGACACTCGGTCAGTTCACCTACGACGTCCCAAGCGGTCGT
CGTGACTCACTGGTCTCTCATGGGGCAAATGTATCTGACAACATCCCTTTTCCGACAACTGATATTGGATTTCTTGCACAACATTTTGAAGAACGAGGCTTGTCGCTTAGAGACATGGTG
GCGCTTTCTGGAGCACATTCTATTGGAAGGACGGGTTGTCCAGAATTTACCGATCGACTTTTCTCGAGCAATGGAACAGAAATAACCGACCCAAGTTTGGACCCAACCTTTGCAGCAACT
TTGAGACAGAAGTGTCCGTTTGGTAGCGGGTTTGATAAGACGGCAGATTTGGACAATGTGACGCCAAATCATCTCGATATTCAGTTCTTTGAGAATTTGAAGAACAAGATGGGAGTTTTG
TCGTCAGATCAAGCAATTGCTACTGACCCTCTTACAGCAGCGATAGTGAGCAGATACCAAGGGAATAGAGCAATATGGATGAGGGATTTCTCAGCGGCCATGGTGAAGATGGGGAAGCTA
CTAGTTTTGACTGGAACTCAAGGGGAGATTAGAAAGGAGTGTCATTTTAGGAAC

Retrieve as FASTA