Entry information : CsaPrx41 (Cucsa.128490.1)
Entry ID 8828
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CsaPrx41 (Cucsa.128490.1)
Name (synonym) CsaPrx41 (Cucsa.128490.1)
Class Class III peroxidase    [Orthogroup: Prx171]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx41
start..stop
S start..stop
CsaPrx40 388 6e-136 13..328 24..338
EcamPrx129-2 333 1e-114 15..328 20..323
EcamPrx130 332 3e-114 27..328 25..323
EferPrx29 333 4e-114 11..328 21..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 500789..501004 216 N° 2 499841..500608 768  
complement(join(499841..500608,500789..501004))


exon

Literature and cross-references CsaPrx41 (Cucsa.128490.1)
DNA ref. Phytozome 12:   scaffold01024 (501004..499841)
Protein sequence: CsaPrx41 (Cucsa.128490.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (306)
PWM (Da):   %s   35323.94 (32842.6)  
PI (pH):   %s   7.98 (7.70) Peptide Signal:   %s   cut: 23 range:23-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKGYFWWSIFGLIAIIGAIKGDDEGLSVGFYSKTCPSAERIVRNSVAKAVVNDPGQAAGIIRLYFHDCIVGGCDGSILLDSIPGITSSFDIERHSPGNPVLRGFEIIDDAKSKLESRCPQTVSCSDILAFAARDSVLVTGGFSYAVPAGRRDGRVSNGSAVFTNVPPITPNIARLKQHFESRGLSLKDMVALSGAHSIGITPCGAFSSRLYFFNETVETDPSLDPKFAAFLKTQCPKGKIGGTADLDNVTPNLLDVQFYENLRRKMGVLSSDQAMEDDPLTAATVREYRSSRSLWKADFTAAMVKLGNMKVLTGRQGEIRKNCSALN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAAAGGGTTACTTTTGGTGGAGCATTTTTGGGTTAATTGCCATAATTGGAGCCATAAAAGGTGATGATGAAGGATTGAGTGTAGGGTTTTATAGTAAAACATGCCCTTCTGCAGAA
CGAATTGTGAGAAATTCTGTTGCTAAAGCTGTGGTTAATGATCCTGGCCAAGCTGCTGGCATTATTCGATTGTATTTCCATGATTGCATTGTTGGG
GTATCTGTTCTTATACACTCATAT
GCCTTTTTTAAAAAAATATCCGTTGAGGTTAAAAAAAAGTCATTTTGTTTACACACTTTTACTTTGCACCATTTTAATTAATTTCTAAATTTAGTTTATATGTATTGTTAATACATCTTA
AATAAATGATATACATATTATTATGGAAATCACCAGGGCTGCGATGGTTCCATTCTTCTAGATTCAATCCCAGGTATTACCAGCTCCTTCGACATAGAACGGCATAGTCCAGGCAACCCT
GTACTCCGAGGATTTGAAATCATCGACGATGCTAAATCCAAGCTTGAATCTCGATGTCCTCAAACAGTATCTTGTTCGGACATCTTAGCCTTCGCTGCCCGTGACAGCGTCCTTGTCACC
GGAGGCTTCTCTTACGCTGTCCCTGCTGGGCGTCGTGATGGTCGAGTCTCCAACGGCTCTGCCGTGTTCACCAACGTTCCTCCTATAACACCTAATATTGCTCGCCTCAAACAACACTTT
GAATCAAGAGGGCTATCCTTAAAAGACATGGTGGCTCTGTCCGGAGCACACTCCATTGGTATTACGCCGTGTGGGGCATTCTCCAGCCGCCTTTATTTTTTCAATGAGACGGTCGAGACG
GATCCGTCGCTGGATCCGAAATTTGCAGCGTTTTTGAAAACCCAATGTCCTAAAGGGAAGATTGGTGGGACAGCGGATTTGGACAATGTGACGCCGAATTTGCTTGACGTTCAGTTTTAT
GAGAATTTGAGGAGGAAGATGGGGGTTTTGAGCTCTGATCAGGCGATGGAAGATGACCCATTGACGGCAGCGACGGTGAGAGAATATCGTAGTAGTCGAAGCCTTTGGAAGGCGGATTTC
ACGGCGGCGATGGTGAAGCTGGGGAATATGAAGGTTTTGACTGGAAGGCAAGGGGAGATTAGAAAGAATTGTAGTGCTTTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAAAGGGTTACTTTTGGTGGAGCATTTTTGGGTTAATTGCCATAATTGGAGCCATAAAAGGTGATGATGAAGGATTGAGTGTAGGGTTTTATAGTAAAACATGCCCTTCTGCAGAA
CGAATTGTGAGAAATTCTGTTGCTAAAGCTGTGGTTAATGATCCTGGCCAAGCTGCTGGCATTATTCGATTGTATTTCCATGATTGCATTGTTGGG
GGCTGCGATGGTTCCATTCTTCTA
GATTCAATCCCAGGTATTACCAGCTCCTTCGACATAGAACGGCATAGTCCAGGCAACCCTGTACTCCGAGGATTTGAAATCATCGACGATGCTAAATCCAAGCTTGAATCTCGATGTCCT
CAAACAGTATCTTGTTCGGACATCTTAGCCTTCGCTGCCCGTGACAGCGTCCTTGTCACCGGAGGCTTCTCTTACGCTGTCCCTGCTGGGCGTCGTGATGGTCGAGTCTCCAACGGCTCT
GCCGTGTTCACCAACGTTCCTCCTATAACACCTAATATTGCTCGCCTCAAACAACACTTTGAATCAAGAGGGCTATCCTTAAAAGACATGGTGGCTCTGTCCGGAGCACACTCCATTGGT
ATTACGCCGTGTGGGGCATTCTCCAGCCGCCTTTATTTTTTCAATGAGACGGTCGAGACGGATCCGTCGCTGGATCCGAAATTTGCAGCGTTTTTGAAAACCCAATGTCCTAAAGGGAAG
ATTGGTGGGACAGCGGATTTGGACAATGTGACGCCGAATTTGCTTGACGTTCAGTTTTATGAGAATTTGAGGAGGAAGATGGGGGTTTTGAGCTCTGATCAGGCGATGGAAGATGACCCA
TTGACGGCAGCGACGGTGAGAGAATATCGTAGTAGTCGAAGCCTTTGGAAGGCGGATTTCACGGCGGCGATGGTGAAGCTGGGGAATATGAAGGTTTTGACTGGAAGGCAAGGGGAGATT
AGAAAGAATTGTAGTGCTTTGAAT

Retrieve as FASTA