Entry information : CsaPrx42 (Cucsa.129220.1)
Entry ID 8829
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CsaPrx42 (Cucsa.129220.1)
Name (synonym) CsaPrx42 (Cucsa.129220.1)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx42
start..stop
S start..stop
CsaPrx55 390 1e-136 7..328 8..320
CpPrx01 386 3e-135 24..329 16..316
CsaPrx01 375 4e-131 6..329 3..320
CsaPrx06 374 2e-130 7..327 9..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 252520..252732 213 N° 2 252216..252410 195 N° 3 251912..252077 166 N° 4 250872..251302 431
complement(join(250872..251302,251912..252077,252216..252410,252520..252732))


exon

Literature and cross-references CsaPrx42 (Cucsa.129220.1)
DNA ref. Phytozome 12:   scaffold01028 (252732..250872)
Protein sequence: CsaPrx42 (Cucsa.129220.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (311)
PWM (Da):   %s   35824.75 (33145.3)  
PI (pH):   %s   4.48 (4.35) Peptide Signal:   %s   cut: 25 range:25-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSKALPYILLITMLFTVRPTTAQLCPSFYDTTCPNLPSIVEDVVRQALQTDARAGAKLIRFHFHDCFVNGCDGSVLLEDSVADGIDSEQNAPGNLGIQGQNIVADIKTAVENACPNVVSCADILAIASNSAVVLAGGRGWEVQLGRRDSRIANRSGAVSNLPSPFEPLANLTVKFANVGLNSTDLVSLSGAHTFGQSRCRFFQGRLSNFSGTGMADPSLDPIYRDMLLEACPQGGDNNRVNLDPTTPNEFDNNYFTNLQDNRGLLTSDQVLFSPPGAATTVDVDRFAASQEVFFDAFGASMIKMGNIMPLTTIDGEIRLTCSRINPLPTLAD

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTCCAAAGCACTGCCCTATATTCTCCTCATCACCATGCTGTTCACCGTCCGGCCAACCACAGCGCAGTTGTGCCCGTCGTTCTACGACACCACATGTCCCAACCTACCCTCC
ATTGTAGAAGATGTAGTGAGACAAGCTCTCCAAACCGATGCCCGAGCAGGCGCTAAACTCATTCGCTTTCATTTCCACGATTGTTTCGTCAAT
GTTAGTAACTTCCCTATCTCTCACATC
CTTGTAGTTTAAGCTTAAAGCTAATAAGTTACCGTTATATATATATTTAATTTACGTGTTTTTACATTCTTTCACATGTCAGGGATGTGATGGGTCTGTTCTACTTGAAGATTCAGTCGC
AGATGGTATAGATAGTGAACAAAACGCACCCGGAAACCTTGGAATCCAAGGCCAAAATATTGTCGCTGACATCAAAACTGCTGTTGAAAATGCATGTCCAAACGTTGTCTCCTGTGCTGA
CATCTTAGCCATTGCATCTAATTCAGCCGTCGTCTTG
GTAAAGACATTATCTGTCACCTTCTTAATTTATGGTGAATTCAAAATAGATACTTTAGTCTTAAAAAAGTAAGTTGTGAATTG
AATGTTATTTATTTCTGNNNNNNNNNNNNNNNNNNNNNGTTTATCATTTTGTCAGGCAGGAGGAAGGGGTTGGGAGGTTCAACTAGGAAGAAGAGATAGCAGAATAGCAAATAGATCAGG
AGCTGTGAGTAATCTTCCAAGTCCTTTTGAACCTCTTGCAAATCTTACTGTCAAGTTTGCCAACGTTGGTCTTAATTCTACCGATCTTGTCTCTTTATCTG
GTAAGTCTCTAATAATCAC
AATAATAATTATCTCATATTGTTAATTATATCTCCTTCTACCATACCTTCTTAAACATATATATTTAAATCATAATTGAAAAAGGATCGAATAATCTTTAAGATTGAGATTAGATATACA
TTAATCGTATTAGTTAAGCTATATATATATACTCATTCTTAGCAGGTTTGTCTGTTTGTTTAATAATTTATTTGTTTAAGTACATGCATTTAATAAAGTTTAGGTGTGATTTGAATAATA
ATTCAATGGCAAGTGAGCTTCTTGCTTTTTCTTTTTTCTATTTAATTATTTTATTAGATCCTAGTCGTGTGCATTAAGTTCTTTTTTTTGGTTAAAGACAAAGAGGTGTGATATTACTTT
GACTAGTTAGATATATACTTCTAAGTTATAAAGGGAAAGAAAAACCAAGAAGAGATAATATTATTTACAAATAAAAAGAAGAATTGATGAAAAAGAAATGTTGAACTTAATGAAATGATT
ACTTTCCCGTCACGTCCAATATTTCATATCAGAGAAGCTTTCCACATAAACTTACATGATGTATTTGTAAATATTCGTAGTTGAAAATCGTCATTGACATGTATTTTTAGGGGCGCACAC
GTTTGGTCAATCAAGATGTCGATTCTTCCAAGGACGATTGAGCAACTTTAGTGGAACGGGAATGGCTGATCCGAGTCTAGACCCAATCTATAGAGACATGCTTTTGGAGGCATGTCCTCA
AGGCGGAGACAACAACCGGGTGAACCTAGACCCAACAACTCCCAATGAATTTGACAACAACTATTTCACCAATCTCCAAGACAACCGTGGGCTTCTTACAAGCGACCAAGTACTGTTCTC
CCCTCCCGGAGCTGCGACCACCGTTGACGTGGACCGCTTCGCAGCAAGCCAAGAAGTGTTCTTTGATGCTTTTGGAGCCTCCATGATCAAGATGGGGAATATTATGCCATTGACTACAAT
TGATGGGGAGATACGTTTAACTTGTTCTAGGATTAATCCTTTGCCTACTCTTGCTGATATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTCCAAAGCACTGCCCTATATTCTCCTCATCACCATGCTGTTCACCGTCCGGCCAACCACAGCGCAGTTGTGCCCGTCGTTCTACGACACCACATGTCCCAACCTACCCTCC
ATTGTAGAAGATGTAGTGAGACAAGCTCTCCAAACCGATGCCCGAGCAGGCGCTAAACTCATTCGCTTTCATTTCCACGATTGTTTCGTCAAT
GGATGTGATGGGTCTGTTCTACTTGAA
GATTCAGTCGCAGATGGTATAGATAGTGAACAAAACGCACCCGGAAACCTTGGAATCCAAGGCCAAAATATTGTCGCTGACATCAAAACTGCTGTTGAAAATGCATGTCCAAACGTTGTC
TCCTGTGCTGACATCTTAGCCATTGCATCTAATTCAGCCGTCGTCTTG
GCAGGAGGAAGGGGTTGGGAGGTTCAACTAGGAAGAAGAGATAGCAGAATAGCAAATAGATCAGGAGCTGTG
AGTAATCTTCCAAGTCCTTTTGAACCTCTTGCAAATCTTACTGTCAAGTTTGCCAACGTTGGTCTTAATTCTACCGATCTTGTCTCTTTATCTG
GGGCGCACACGTTTGGTCAATCAAGA
TGTCGATTCTTCCAAGGACGATTGAGCAACTTTAGTGGAACGGGAATGGCTGATCCGAGTCTAGACCCAATCTATAGAGACATGCTTTTGGAGGCATGTCCTCAAGGCGGAGACAACAAC
CGGGTGAACCTAGACCCAACAACTCCCAATGAATTTGACAACAACTATTTCACCAATCTCCAAGACAACCGTGGGCTTCTTACAAGCGACCAAGTACTGTTCTCCCCTCCCGGAGCTGCG
ACCACCGTTGACGTGGACCGCTTCGCAGCAAGCCAAGAAGTGTTCTTTGATGCTTTTGGAGCCTCCATGATCAAGATGGGGAATATTATGCCATTGACTACAATTGATGGGGAGATACGT
TTAACTTGTTCTAGGATTAATCCTTTGCCTACTCTTGCTGATATG

Retrieve as FASTA