Entry information : CsaPrx43 (Cucsa.134680.1)
Entry ID 8830
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CsaPrx43 (Cucsa.134680.1)
Name (synonym) CsaPrx43 (Cucsa.134680.1)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx43
start..stop
S start..stop
PpePrx71 484 1.77e-173 19..342 27..350
LjPrx50 460 9.42e-164 28..342 36..349
GmPrx64 459 9.66e-164 41..341 40..340
MtPrx100 443 2.95e-157 11..342 16..342
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8830' 'complement(join(272178..272581,273139..273481,273719..274000))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 273719..274000 280 N° 2 273139..273481 341 N° 3 272178..272581 402  
complement(join(272178..272581,273139..273481,273719..274000))


exon

Literature and cross-references CsaPrx43 (Cucsa.134680.1)
DNA ref. Phytozome 12:   scaffold01043 (274000..272178)
Protein sequence: CsaPrx43 (Cucsa.134680.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (323)
PWM (Da):   %s   38004.26 (35894.1)  
PI (pH):   %s   6.06 (5.75) Peptide Signal:   %s   cut: 21 range:21-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKWGVLLVLILASATAVSWAEKDFEDDGEEYPSLEIPQLKDFSAF
GDFLTYGFYQKSCPGVEGIIHRKVKQWFDKDNTIAAGLLRLHFHDCVVR
GCDGSILLDYEGSERRAPASKTLRGFEVIDDIKAELEKKCPKTVSCADILTAAAREATVLMGGPYWMVPYGRRDGVDSIAKETELVPMGIEDITSLIELYQSLGLNVLDLVVLSGAHTIG
RATCGVVQERLYNYSATGKPDPSLNPKYLNFLRRKCRWATDYADLDATTPNKFDNAYYSNLPKKMGLLSSDAALYTDSRTSPIVKALAYQPSIFRHQFAVSMAKLGNVQVLTDLFEGEIR
TKCSCRNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATGGGGGGTTCTTCTTGTTCTTATTCTGGCCTCCGCCACCGCAGTGTCGTGGGCCGAGAAAGATTTTGAGGATGACGGAGAAGAATACCCGAGCCTTGAGATTCCGCAGTTGAAG
GATTTTTCAGCTTTTGGGGACTTTCTTACTTATGGGTTCTACCAGAAAAGTTGCCCCGGCGTCGAAGGCATTATTCACCGTAAAGTCAAGCAGTGGTTCGATAAAGACAACACCATTGCC
GCTGGCCTCTTGAGATTGCACTTTCATGACTGCGTCGTCAGG
GTAAATACAGCTCTCTCTCTACCATCTTTCTTTTCTACTCTTAATATTTTTGTCTGGCCTAAAATGAGGCCTAAAAAG
CACTAAAATAGTTTTACTAGAAAATAAATAAGAGAGTTAACTCATTGATACGCAAATAATAAATAAACAGTACTTAATATCTAAACTAAACATTAAGTAAAATAGAGGGAAAATTGGCAC
TAACATGCATGGGCTCCGGGCGGGGTTGTGCAATTGCAGGGGGCTGCGATGGTTCTATTCTTCTGGATTACGAGGGAAGTGAGAGACGGGCTCCGGCGAGCAAGACACTTAGAGGTTTCG
AAGTGATCGACGATATCAAAGCTGAGTTAGAGAAAAAGTGCCCGAAAACAGTTTCTTGCGCTGATATTTTAACCGCTGCTGCGAGAGAAGCGACGGTCCTCATGGGAGGGCCTTATTGGA
TGGTACCATATGGAAGAAGAGATGGAGTTGATTCCATTGCCAAAGAAACAGAATTAGTGCCAATGGGTATTGAAGACATCACTTCTCTCATTGAATTATACCAATCTCTTGGCTTGAATG
TCCTCGATTTGGTCGTTCTTTCAG
GTATACATTCTTACTATCTAACTCTTACGGTGTTACCTTTCAACTGATTTGTGTTAAGTACTTAACATTAAAACCTCTCGGTTATACCTTAATTTT
GTCCCTAATCTTTAATTAAATTAAATTAGATAAAATGAGGTGTTATTTGTGCATTTCAGTCTTAGTAAGTTCCAAATTTGAAATCTTAACTCGCTTAGCTAGATTGTCTATGGATTTTAT
CCAATTAGATTTCAAATGATTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAAGTAAATTTAGGTCGGTATTAACATGACTTATGTCTTTAGAGGGTGAA
AGTTAAATTCTATACGCGTACTAAAAAAAAGATAGAAACCTTATACAATGAATGAAATTATCCAAAAATAATGACACTAATTATCATGATAATGGTTTATGGCTTAATTCCAACCCTAGA
TCTAAAAAAGCTCCATTTTCACTTGTTTGCATTTGTGTATACAAATCTTTAAATTTACCGTCATTCATGAACTGGAAGAATGAATTGGAAATTTTGTGAAGGGGGGCACACACAATCGGA
AGGGCAACGTGTGGAGTGGTACAAGAAAGACTTTACAATTACAGCGCAACTGGAAAACCCGACCCATCATTGAATCCAAAATACTTAAACTTCTTGAGAAGGAAATGCCGATGGGCCACC
GACTACGCGGACCTTGACGCTACAACTCCCAACAAATTCGACAACGCCTATTACTCCAATCTCCCAAAAAAGATGGGTCTTTTGTCCTCTGATGCCGCTCTCTATACCGATTCAAGAACT
TCCCCTATTGTTAAAGCCTTGGCCTATCAGCCCTCCATTTTCCGCCACCAATTTGCTGTCTCCATGGCTAAGCTTGGGAACGTTCAAGTTCTTACTGACCTTTTCGAAGGCGAGATTCGA
ACCAAATGCAGTTGTAGGAATTCTCCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATGGGGGGTTCTTCTTGTTCTTATTCTGGCCTCCGCCACCGCAGTGTCGTGGGCCGAGAAAGATTTTGAGGATGACGGAGAAGAATACCCGAGCCTTGAGATTCCGCAGTTGAAG
GATTTTTCAGCTTTTGGGGACTTTCTTACTTATGGGTTCTACCAGAAAAGTTGCCCCGGCGTCGAAGGCATTATTCACCGTAAAGTCAAGCAGTGGTTCGATAAAGACAACACCATTGCC
GCTGGCCTCTTGAGATTGCACTTTCATGACTGCGTCGTCAGG
GGCTGCGATGGTTCTATTCTTCTGGATTACGAGGGAAGTGAGAGACGGGCTCCGGCGAGCAAGACACTTAGAGGTTTC
GAAGTGATCGACGATATCAAAGCTGAGTTAGAGAAAAAGTGCCCGAAAACAGTTTCTTGCGCTGATATTTTAACCGCTGCTGCGAGAGAAGCGACGGTCCTCATGGGAGGGCCTTATTGG
ATGGTACCATATGGAAGAAGAGATGGAGTTGATTCCATTGCCAAAGAAACAGAATTAGTGCCAATGGGTATTGAAGACATCACTTCTCTCATTGAATTATACCAATCTCTTGGCTTGAAT
GTCCTCGATTTGGTCGTTCTTTCAG
GGGCACACACAATCGGAAGGGCAACGTGTGGAGTGGTACAAGAAAGACTTTACAATTACAGCGCAACTGGAAAACCCGACCCATCATTGAATCCA
AAATACTTAAACTTCTTGAGAAGGAAATGCCGATGGGCCACCGACTACGCGGACCTTGACGCTACAACTCCCAACAAATTCGACAACGCCTATTACTCCAATCTCCCAAAAAAGATGGGT
CTTTTGTCCTCTGATGCCGCTCTCTATACCGATTCAAGAACTTCCCCTATTGTTAAAGCCTTGGCCTATCAGCCCTCCATTTTCCGCCACCAATTTGCTGTCTCCATGGCTAAGCTTGGG
AACGTTCAAGTTCTTACTGACCTTTTCGAAGGCGAGATTCGAACCAAATGCAGTTGTAGGAATTCTCCT

Retrieve as FASTA