Entry information : CsaPrx45 ( Cucsa.151970.1)
Entry ID 8832
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2016-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-27 (Achraf Jemmat)
Peroxidase information: CsaPrx45 ( Cucsa.151970.1)
Name (synonym) CsaPrx45 ( Cucsa.151970.1)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx45
start..stop
S start..stop
GmPrx249 431 3e-153 13..322 15..319
GmPrx74 430 6e-153 17..322 19..320
MguPrx71 423 2e-150 17..322 2..309
RcPrx52 422 9e-150 8..322 7..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 282404..282613 210 N° 2 282067..282258 192 N° 3 281241..281406 166 N° 4 280749..281149 401
complement(join(280749..281149,281241..281406,282067..282258,282404..282613))


exon

Literature and cross-references CsaPrx45 ( Cucsa.151970.1)
DNA ref. Phytozome 12:   scaffold01119 (282613..280752)
Protein sequence: CsaPrx45 ( Cucsa.151970.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (299)
PWM (Da):   %s   34457.99 (32078.9)  
PI (pH):   %s   5.33 (5.33) Peptide Signal:   %s   cut: 24 range:24-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGPNCSNLWCVLVFASLVTLSSGSLSAKFYASTCPKLLSIVRSEVVKAVDKEYRMGASLLRLHFHDCFVNGCDASVLLDDTSNFTGEKTAIPNKDSLRGFEVIDSIKTLVEAACPSVVSCADILSLAARDSVIALGGPSWVVGLGRRDSTTASFDNANNDLPSPFLDLPDLISAFSNKGFDTKELVALSGSHTIGQARCSMFRVRAHNETTTIDPDFAASLRTNCPFSGDDQNLSPLDLNTQSLFDNAYFKNLVQNKGLLHSDQALFTNSSSPSSADSHVNSYISDPKAFFSDFAAAMVKMSNLSPLTGSDGQIRSDCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGACCAAATTGCAGCAACTTGTGGTGTGTTTTGGTGTTTGCTTCATTGGTAACTTTGAGCTCTGGCAGTTTATCTGCCAAGTTCTATGCGAGTACATGCCCAAAGTTACTTTCTATT
GTCCGAAGTGAAGTCGTGAAAGCAGTAGATAAAGAGTATAGAATGGGAGCATCGTTGCTTCGCCTTCACTTTCACGATTGCTTTGTCAAT
GCATGTGATCTATATCTTTAACTCATTTTG
TATTTTATAATATTTGTCTCATGTCTACATTTAAGTACATTTTAGGGGAAAAAATGATTGCATTTTATAATACATTCAAGTATTGTTAATAAAATGGTTATATATGTTCATGTAGGGATG
TGATGCGTCGGTGCTGTTGGATGACACATCAAACTTTACCGGAGAAAAAACGGCGATTCCAAATAAAGATTCACTAAGAGGTTTTGAAGTGATCGACTCAATAAAAACGTTGGTGGAGGC
TGCTTGTCCTTCTGTGGTTTCTTGTGCTGATATTTTGTCTCTTGCAGCTCGAGATTCTGTAATTGCA
GTAAGTTCAAACCTATCCATTCTAAAAGAGTAATTACAATTAGTAGCACTAAC
AATGTATGCTAACATTTTAAAATTTGTTTTTGCATGGTATTACTTTTGCTAATACTTGCAATTGTCTAGACAAATAAGAAGAATATATTTACTAATACTTAATTGTAATTGTAATTCTTT
TGCATGGTACTATCTTTCCTAATTTTTATATTTGCAATTGTCTCTTTCATGTTTGTTTTTTCATAAATTCCATGCTATAAATATTAAAATATTTTTTAGTCATTTCTTTTTAAAATGTTT
TCTTTAAAAAAAAAAAATTAGATTTAGTTTTGAAACATCAATTAGCAAATGAATGAGGAAATATTATTTATAAGTTTAATTTATTAATTAAAGTTGTAAAATTTTATAAGTCAACTAAGA
ATGTAGGGTTTTAAATAGATTTTATTTTGAAAATGTGTTATGAAATATAAAATCTAATTGCAAATTTAGTTAATTAGTCTATAAGGATGGATGGATGTATAAGACATATGATATGATTAG
GAGTATAAAATGATATTTGGATCCCAATGTTCTTAATAGATAGGTTATAGTAAGTATTTATAAAAAGATAGGAAAGATATGCATGCATGCATTTGCATAATATAATGCTTTGGTTTGGTT
TTTGGAGCTTGGAGGGCCTTCGTGGGTAGTTGGACTTGGGCGGAGGGACTCAACCACAGCCAGCTTCGACAACGCAAACAATGACCTTCCTTCTCCCTTCCTCGACCTTCCTGATCTCAT
CTCTGCCTTTTCTAACAAAGGCTTCGACACCAAAGAATTGGTCGCCCTTTCAG
GTTTTTCACTTTTCTTTTTCTTTTTTTATCCTTAATTGATTCATCTCCAAAAACAAAAAGTTAACCA
CCCTTGATTTGATGTTTCTTGAAGGATCTCACACAATTGGACAAGCAAGGTGCTCCATGTTCAGAGTAAGGGCCCATAACGAAACAACCACCATTGATCCAGATTTTGCAGCCTCTCTAA
GAACCAACTGCCCTTTCTCCGGCGACGATCAAAACCTTTCCCCTTTGGATCTCAATACTCAATCCTTGTTCGACAACGCTTATTTCAAAAATTTGGTTCAAAACAAAGGCCTTCTTCACT
CCGATCAAGCTCTCTTCACCAACTCCTCCTCCCCCTCCTCCGCAGATTCTCACGTCAATTCCTACATCTCCGACCCTAAAGCTTTCTTCTCCGACTTCGCCGCCGCCATGGTTAAGATGT
CCAACCTCTCCCCTCTCACCGGCTCCGACGGCCAGATTCGCTCCGACTGCCGTAAAATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGACCAAATTGCAGCAACTTGTGGTGTGTTTTGGTGTTTGCTTCATTGGTAACTTTGAGCTCTGGCAGTTTATCTGCCAAGTTCTATGCGAGTACATGCCCAAAGTTACTTTCTATT
GTCCGAAGTGAAGTCGTGAAAGCAGTAGATAAAGAGTATAGAATGGGAGCATCGTTGCTTCGCCTTCACTTTCACGATTGCTTTGTCAAT
GGATGTGATGCGTCGGTGCTGTTGGATGAC
ACATCAAACTTTACCGGAGAAAAAACGGCGATTCCAAATAAAGATTCACTAAGAGGTTTTGAAGTGATCGACTCAATAAAAACGTTGGTGGAGGCTGCTTGTCCTTCTGTGGTTTCTTGT
GCTGATATTTTGTCTCTTGCAGCTCGAGATTCTGTAATTGCA
CTTGGAGGGCCTTCGTGGGTAGTTGGACTTGGGCGGAGGGACTCAACCACAGCCAGCTTCGACAACGCAAACAATGAC
CTTCCTTCTCCCTTCCTCGACCTTCCTGATCTCATCTCTGCCTTTTCTAACAAAGGCTTCGACACCAAAGAATTGGTCGCCCTTTCAG
GATCTCACACAATTGGACAAGCAAGGTGCTCC
ATGTTCAGAGTAAGGGCCCATAACGAAACAACCACCATTGATCCAGATTTTGCAGCCTCTCTAAGAACCAACTGCCCTTTCTCCGGCGACGATCAAAACCTTTCCCCTTTGGATCTCAAT
ACTCAATCCTTGTTCGACAACGCTTATTTCAAAAATTTGGTTCAAAACAAAGGCCTTCTTCACTCCGATCAAGCTCTCTTCACCAACTCCTCCTCCCCCTCCTCCGCAGATTCTCACGTC
AATTCCTACATCTCCGACCCTAAAGCTTTCTTCTCCGACTTCGCCGCCGCCATGGTTAAGATGTCCAACCTCTCCCCTCTCACCGGCTCCGACGGCCAGATTCGCTCCGACTGCCGTAAA
ATCAATTAA

Retrieve as FASTA