Entry information : CsaPrx54 ( Cucsa.153440.1)
Entry ID 8834
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-27 (Christophe Dunand)
Peroxidase information: CsaPrx54 ( Cucsa.153440.1)
Name (synonym) CsaPrx54 ( Cucsa.153440.1)
Class Class III peroxidase    [Orthogroup: Prx254]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx54
start..stop
S start..stop
CsaPrx04 490 3e-176 1..322 1..322
CsaPrx55 426 5e-151 3..322 6..320
CpPrx01 417 1e-147 20..330 14..325
CsaPrx03 407 2e-143 13..321 11..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 548316..548522 207 N° 2 548014..548205 192 N° 3 547310..547900 591  
complement(join(547310..547900,548014..548205,548316..548522))


exon

Literature and cross-references CsaPrx54 ( Cucsa.153440.1)
DNA ref. Phytozome 12:   scaffold01124 (548522..547310)
Protein sequence: CsaPrx54 ( Cucsa.153440.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (308)
PWM (Da):   %s   35318.89 (33144.6)  
PI (pH):   %s   5.62 (5.28) Peptide Signal:   %s   cut: 23 range:23-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPKLTPLVAVVALMLAPSLAQLNPFFYTFTCPQLPFIVLNTVSQALQTDDRAAAKLIRLHFHDCFANGCDGSVLLEDVPGVIDSELNAAPNNGIQGLDIVDNIKAAVESACPGVVSCADILALSSQVSVVLSGGPAWIVPLGRKDSRIANRAAAANLPSPFETLDVLKSKFAAFGMSSTDLVTLSGAHTFGRARCFFFTGRFDNFNNTGVPDPTLDAAYREQLRQLCATPVTRVNFDPTTPDTFDKNYYTNLQNHKGLLQSDQELFSTPGADTIGIVNTFAASQLLFFIQFGNSMIKMGNLGPPPGTPSEVRLNCRKINPPTTFHDVI

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCCCTAAACTTACACCCCTTGTTGCAGTGGTAGCTTTGATGCTTGCTCCCTCTCTCGCTCAGCTTAACCCTTTCTTCTACACCTTCACTTGCCCTCAACTACCTTTCATTGTT
CTAAATACAGTCTCTCAAGCTCTTCAAACCGATGACCGAGCTGCTGCCAAGCTCATTCGTCTCCACTTCCATGACTGCTTTGCCAAT
GCACGTACTCATCATAAACCTACTTGAATTCAT
TTTTCTAACTACTTAAATACATTTTTTTTTTTAGTTAAACATCTTCTGATATATTGGATGTTGGGTCATTTATGTAGGGGTGTGATGGATCTGTGCTATTGGAAGACGTACCTGGTGTTA
TCGACAGTGAATTGAACGCAGCTCCAAACAATGGAATCCAAGGGTTAGACATTGTGGACAACATCAAAGCAGCAGTTGAAAGCGCATGTCCAGGCGTTGTTTCTTGTGCTGACATATTAG
CCCTCTCATCTCAAGTGTCTGTTGTGCTG
GTAGGTATCGATGATTTCATCCTGTTATACTTATAAATAAGTTAGGTAGCTCGTTTTACTATATTTGAAACTTATCTCTCTAATTAAAACA
AGATTGTTAATTACTGCAATAGTCTGGAGGGCCAGCATGGATCGTCCCATTGGGAAGAAAAGACAGCAGAATAGCAAATAGAGCCGCAGCTGCAAATCTGCCAAGTCCATTCGAAACTCT
AGACGTGCTGAAATCCAAATTTGCAGCCTTCGGGATGAGTTCTACGGATCTTGTGACCCTATCGGGAGCGCACACATTCGGTCGAGCAAGATGTTTCTTCTTCACAGGACGGTTCGACAA
CTTCAACAACACTGGCGTACCCGACCCGACTCTAGACGCCGCATACAGGGAGCAGCTACGCCAACTTTGTGCCACTCCAGTAACAAGAGTAAACTTTGATCCAACCACACCAGACACATT
CGATAAAAACTATTACACTAATCTCCAAAACCATAAAGGGCTTCTCCAAAGTGATCAAGAGCTTTTCTCAACCCCTGGGGCCGATACAATTGGCATTGTCAACACATTTGCTGCTAGTCA
GCTTCTGTTCTTTATTCAATTTGGGAATTCCATGATCAAAATGGGGAATCTTGGCCCTCCGCCTGGCACCCCATCTGAAGTCAGATTGAACTGCAGGAAGATCAACCCACCCACGACCTT
CCATGATGTTATC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCCCTAAACTTACACCCCTTGTTGCAGTGGTAGCTTTGATGCTTGCTCCCTCTCTCGCTCAGCTTAACCCTTTCTTCTACACCTTCACTTGCCCTCAACTACCTTTCATTGTT
CTAAATACAGTCTCTCAAGCTCTTCAAACCGATGACCGAGCTGCTGCCAAGCTCATTCGTCTCCACTTCCATGACTGCTTTGCCAAT
GGGTGTGATGGATCTGTGCTATTGGAAGACGTA
CCTGGTGTTATCGACAGTGAATTGAACGCAGCTCCAAACAATGGAATCCAAGGGTTAGACATTGTGGACAACATCAAAGCAGCAGTTGAAAGCGCATGTCCAGGCGTTGTTTCTTGTGCT
GACATATTAGCCCTCTCATCTCAAGTGTCTGTTGTGCTG
TCTGGAGGGCCAGCATGGATCGTCCCATTGGGAAGAAAAGACAGCAGAATAGCAAATAGAGCCGCAGCTGCAAATCTGCCA
AGTCCATTCGAAACTCTAGACGTGCTGAAATCCAAATTTGCAGCCTTCGGGATGAGTTCTACGGATCTTGTGACCCTATCGGGAGCGCACACATTCGGTCGAGCAAGATGTTTCTTCTTC
ACAGGACGGTTCGACAACTTCAACAACACTGGCGTACCCGACCCGACTCTAGACGCCGCATACAGGGAGCAGCTACGCCAACTTTGTGCCACTCCAGTAACAAGAGTAAACTTTGATCCA
ACCACACCAGACACATTCGATAAAAACTATTACACTAATCTCCAAAACCATAAAGGGCTTCTCCAAAGTGATCAAGAGCTTTTCTCAACCCCTGGGGCCGATACAATTGGCATTGTCAAC
ACATTTGCTGCTAGTCAGCTTCTGTTCTTTATTCAATTTGGGAATTCCATGATCAAAATGGGGAATCTTGGCCCTCCGCCTGGCACCCCATCTGAAGTCAGATTGAACTGCAGGAAGATC
AACCCACCCACGACCTTCCATGATGTTATC

Retrieve as FASTA