Entry information : CsaPrx55 (Cucsa.153450.1)
Entry ID 8835
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: CsaPrx55 (Cucsa.153450.1)
Name (synonym) CsaPrx55 (Cucsa.153450.1)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx55
start..stop
S start..stop
CsaPrx03 436 6.48e-155 13..319 8..320
CmPrx02 433 1.96e-153 13..319 14..326
CpPrx01 426 5.81e-151 23..319 14..314
CsaPrx54 413 8.84e-146 6..320 3..322
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8835' 'complement(join(551941..552368,552446..552611,552697..552885,552987..553202))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 552987..553202 214 N° 2 552697..552885 187 N° 3 552446..552611 164 N° 4 551941..552368 426
complement(join(551941..552368,552446..552611,552697..552885,552987..553202))


exon

Literature and cross-references CsaPrx55 (Cucsa.153450.1)
DNA ref. Phytozome 12:   scaffold01124 (553202..551941)
Protein sequence: CsaPrx55 (Cucsa.153450.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (308)
PWM (Da):   %s   35927.12 (33233.8)  
PI (pH):   %s   7.93 (8.20) Peptide Signal:   %s   cut: 26 range:26-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDSSNSPLFFPLFCLLGFLVGHSLAQLNPSFYAKTCPNLPNIVNA
VVAKALQTDARAGAKLIRLHFHDCFVD
GCDASVLLENAPGIDSELDAPGNQGIQGLNIVDDIKSAVEKACPRTVSCADILAIASKESVVLAGGPSWVVPLGRRDSRTANKEGATNNLASPFEDLNALKAKFGAFGLNSTDLVALSGA
HTFGRSRCAFFSQRFDTPDPTLDPAYREQLKRICSSGSETRANFDPTTPDTFDKNYYTNLQGLRGLLESDQVLFSTSGADTVGIVNRFAKKQGEFFKSFGQSMIKMGNITPLTGNKGEIR
LNCRRVNPRRPRSTDEGRDF

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATTCTTCTAACTCTCCACTATTCTTCCCATTGTTTTGCTTATTGGGTTTCCTGGTGGGACACTCTTTGGCTCAACTAAACCCTTCATTTTACGCCAAAACATGTCCTAATTTACCT
AATATTGTGAATGCTGTCGTTGCTAAGGCTCTGCAAACCGATGCTCGAGCTGGAGCCAAGCTAATTCGTCTCCATTTTCATGACTGCTTTGTTGAC
GTATCCAACTAATTAACAACAAAT
CTCAGTTTCATTCTACATTTTTATGTTTTTTTTTTGCTGAAAACGAAAATTGATGTGAAATATGGGTAATATTGCAGGGGGGTGTGATGCGTCTGTTTTGCTAGAGAATGCACCAGGCAT
AGACAGTGAACTAGATGCCCCTGGAAATCAAGGCATTCAAGGTCTTAACATTGTCGATGACATCAAATCCGCTGTTGAAAAGGCTTGCCCTCGCACTGTCTCTTGTGCTGACATCTTAGC
CATTGCCTCCAAAGAATCCGTCGTATTG
GTAACTAANNNNNNNNNNNNNNNNNNNNNNNACCCACTTTTATTTTTTTAAAAAAAGAGTATAAACAAAGTAGTTTTGAATTCAGGCGCTGG
AGGGCCGAGCTGGGTTGTGCCATTAGGACGAAGAGACAGCAGAACAGCGAATAAAGAAGGAGCCACAAACAACCTCGCCAGTCCCTTTGAAGATCTCAATGCACTCAAAGCCAAATTTGG
TGCTTTCGGTCTCAATTCCACTGATCTCGTGGCTTTGTCTG
GTAAAATTAATACAAAATTAATTAACCATTAACGGTCGGGGTTAAATAATCAAACTAATTATTGGGTTTAAATTCAGGA

GAGCACATACATTTGGGCGTTCAAGGTGCGCATTTTTCAGCCAAAGATTCGACACGCCAGACCCAACGCTGGACCCAGCCTACAGAGAGCAGCTCAAAAGAATTTGCTCAAGTGGGTCAG
AGACAAGAGCCAATTTTGATCCGACGACTCCAGACACATTTGACAAAAACTATTACACGAACCTTCAAGGGCTAAGAGGACTTTTGGAGAGTGATCAAGTACTGTTCTCAACTAGTGGGG
CTGACACGGTGGGGATTGTGAACCGGTTTGCCAAAAAGCAAGGCGAGTTTTTCAAAAGTTTTGGTCAGTCTATGATCAAAATGGGAAATATTACTCCTTTAACCGGAAACAAAGGAGAGA
TTAGATTGAATTGTAGGAGGGTTAATCCAAGAAGGCCTAGAAGTACTGATGAAGGTCGTGATTTTATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATTCTTCTAACTCTCCACTATTCTTCCCATTGTTTTGCTTATTGGGTTTCCTGGTGGGACACTCTTTGGCTCAACTAAACCCTTCATTTTACGCCAAAACATGTCCTAATTTACCT
AATATTGTGAATGCTGTCGTTGCTAAGGCTCTGCAAACCGATGCTCGAGCTGGAGCCAAGCTAATTCGTCTCCATTTTCATGACTGCTTTGTTGAC
GGGTGTGATGCGTCTGTTTTGCTA
GAGAATGCACCAGGCATAGACAGTGAACTAGATGCCCCTGGAAATCAAGGCATTCAAGGTCTTAACATTGTCGATGACATCAAATCCGCTGTTGAAAAGGCTTGCCCTCGCACTGTCTCT
TGTGCTGACATCTTAGCCATTGCCTCCAAAGAATCCGTCGTATTG
GCTGGAGGGCCGAGCTGGGTTGTGCCATTAGGACGAAGAGACAGCAGAACAGCGAATAAAGAAGGAGCCACAAAC
AACCTCGCCAGTCCCTTTGAAGATCTCAATGCACTCAAAGCCAAATTTGGTGCTTTCGGTCTCAATTCCACTGATCTCGTGGCTTTGTCTG
GAGCACATACATTTGGGCGTTCAAGGTGC
GCATTTTTCAGCCAAAGATTCGACACGCCAGACCCAACGCTGGACCCAGCCTACAGAGAGCAGCTCAAAAGAATTTGCTCAAGTGGGTCAGAGACAAGAGCCAATTTTGATCCGACGACT
CCAGACACATTTGACAAAAACTATTACACGAACCTTCAAGGGCTAAGAGGACTTTTGGAGAGTGATCAAGTACTGTTCTCAACTAGTGGGGCTGACACGGTGGGGATTGTGAACCGGTTT
GCCAAAAAGCAAGGCGAGTTTTTCAAAAGTTTTGGTCAGTCTATGATCAAAATGGGAAATATTACTCCTTTAACCGGAAACAAAGGAGAGATTAGATTGAATTGTAGGAGGGTTAATCCA
AGAAGGCCTAGAAGTACTGATGAAGGTCGTGATTTTATG

Retrieve as FASTA