Entry information : CsaPrx56 (Cucsa.153460.1)
Entry ID 8836
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: CsaPrx56 (Cucsa.153460.1)
Name (synonym) CsaPrx56 (Cucsa.153460.1)
Class Class III peroxidase     [Orthogroup: Prx006]*
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx56
start..stop
S start..stop
CsaPrx55 250 1.16e-83 4..188 7..191
CsaPrx03 246 4.5e-82 12..188 10..186
CsaPrx42 244 1.25e-81 1..188 1..192
CsaPrx02 239 2.99e-80 15..188 1..174
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8836' 'complement(join(210942..210959,560766..560951,561048..561236,561332..561538))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 561332..561538 205 N° 2 561048..561236 187 N° 3 560766..560951 184 N° 4 210942..210959 16
complement(join(210942..210959,560766..560951,561048..561236,561332..561538))


exon

Literature and cross-references CsaPrx56 (Cucsa.153460.1)
DNA ref. Phytozome 12:   scaffold01124 (561538..210942)
Protein sequence: CsaPrx56 (Cucsa.153460.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   200 (178)
PWM (Da):   %s   21175.55 (18866.4)  
PI (pH):   %s   4.38 (4.20) Peptide Signal:   %s   cut: 23 range:23-200
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFPKVAALAALLCMMLRGSFAQLSPTFYDQSCPNLTAVVRDTVS
QALQGDVRAGAKLVRFHFHDCFVN
GCDGSVLLENQDGVESELDAPGNQGIQGFDIVDSIKTAVEASCPNTVSCADILAISARESVVLTGGSGWVVQLGRRDSQNANRTGAENNLPSPFETLDQLRAKFNAAGLDSTDLVTLSGN
NLTIL
LYIYIY

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing due to the 'NNNNNNNN' in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCCCTAAAGTTGCAGCTTTAGCAGCCTTGTTGTGTATGATGTTGAGGGGCTCTTTTGCCCAACTCAGCCCTACCTTCTACGACCAGTCTTGCCCTAATCTTACCGCCGTTGTC
AGAGATACTGTAAGCCAGGCATTGCAGGGTGATGTTCGAGCCGGAGCCAAGCTTGTTCGCTTTCACTTCCATGATTGTTTTGTCAAC
GTAAGACCTCATTTGTTATTCTCTTCCACTAGT
TATATGGCGAACTTTAAAATTAATACTTAAGTTGCATTCTATATGACTGAATTTGAGTACAGGGGGTTGTGATGGGTCAGTTTTGTTAGAAAATCAAGATGGTGTAGAGAGTGAATTAGA
TGCACCAGGAAACCAAGGAATACAAGGCTTTGACATTGTCGACAGCATCAAAACTGCAGTTGAAGCTTCTTGTCCAAACACTGTGTCTTGTGCAGATATCTTAGCCATTTCAGCCCGTGA
ATCTGTTGTCTTG
GTAATTTAATTAGTACATATATTTATCAAAAGTTAATATGTTTTCGGTAACAACGTATGGATGTTAAGATTTGAACATGCAATAATCTAAATGCAGACACAGGAGGG
TCAGGTTGGGTAGTCCAATTAGGAAGAAGAGATAGCCAAAATGCAAATAGAACTGGAGCTGAAAACAACCTCCCAAGCCCTTTTGAAACACTCGATCAACTTCGAGCAAAATTTAATGCA
GCTGGGCTCGATTCTACCGATCTTGTGACTTTATCTGGTAATAATTTAACAATTTTA
TNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNTNNNNNNNNNNNNNNNNNNNNAGGGTGTGGGACCCACATCAGTTTTATAAAAAGAGAAAATTCCCCTAACAAAAATATTCAGAAAAAAATAGTGTATCACACCAGTTTT
GNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCCGTCAAAAAAAATATCAAAACCCTACTTTTGCAATATTTATAATATGGAGTTAGGTGAG
CAGCACCACCCCTCTCCTCCACCACTCCACATGAGTACTTCTCCCAATAAGTATATAACACATTTCTACTTTTCTTTCTTTTCTTTTTTAACTTTTGTAAAAAGCGTTTTTAGGTTTCGT
AAATATAGACTCACACTTTGATACCTCAAAGTTTGAAATCAGTATGAAAATCAAGAAAGATCGAGAAAATCGTATAATTAATTCAAAGACGATGTCATTTGACGCTTCAACAACTTTAAC
ATATATTTTGAAACATTTCTTCAATATCGACAAACAGTTAGATAGTGTCTCTCTTATCTAATACCATATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTAGATACCTAATACATCTTCATTCTCATTTGTAATATAGTTAGATAAAAG
AGATAACAAGTAGTTTAGAGAAGAATGATCCATCAGTACAATATATTATGGATACAAAAGTACTCCCAATGATGATGCATAAGAAACAGAAATCAATATAAAACATTTAGATATGCTACT
TGAACTGCACCTCTGATCATTTGTGCAACTCTAAGCAGTTGAAAGTGTGAAGTAGAAAAAGAATTTCTTAAATATTTTTTGGTGCGAGTATAGAAAGGAGAGCAGGGAGTTGTACCTAAT
CATTACTGATACAAAAGAAAAGGGATTCAACACAGTACAAGCAAATAGCAGACTATATTATCAACATGAATAATTAGAAAACTAAACTAACAATCTCCTTAAGGATATATGCCATTCTAC
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAATCGTAGTCTTTTACCTATTTAATTGTCTCATTAGACNNNNNNNNNNNNNNNNNNNNNNGCCCATATAACTTTGTA
TTTTGCATAAAAAAAATGTTTCTAAACTTTTAAAATTTTAAAAGGATTAACAGATACTACACATTTATTATTAGTTTTTTCTATGAGAATGTTAAAGTTAATTTGTATAAAAAAATACAT
TTGAACTATTAAAGTTCATAAATACCCATAAGTTTAAAAAAGAAAAAATTGCAAAAGAAAGGTGGAGAGAAATAAAAATTAAGTAAAAGGATATTAACAACCCAAAATGNNNNNNNNNNN
NNNNNNNNNNNCTTTTGAAAGCTTCGAGGATTTACAAAATGTTTAGTATACGTTGGTAGTCGAAAACGTTTATTTATTTAATTAGTTGTTGTTTTAGTATGTTTTAATGAAAACTATTCT
CTTAAACTTGGTAGGTGAGAAAACTAACCTAAAATTCGGATGAACAAAAGGATTCTACCTTTTATTTTACCCTAAACCCTAAACCCTAAACCATAAAACGTAAAACATAAACTTTACATT
TTGCTTTCTTTTTCCCTTTCAAAGGAAAGTTACATATGATTACATTTTTATTTACTTTCAAAGATGGCGTGCAGTGTTCGAGAGAGACTCTTTTTCCCAATCAAAACTATAGTGTTTCAT
ACAAAAGACAAAAAGAAAGTGAAGGTATGGAAGAATTTAATGTCCATTAAGTTTGGGTTTCTGAATATAATCATCTTTTACGTCACCTTATAAAAGAAAAGAAAAAAACATTATAAACGT
GAGTGTTATATTTGAGGTTATGGGTGATGAACTTTCGCAGATTGTAAACAATACTATGCTTTTAAGTTTTCCACCTTACCTTACAAACTATTACACTTTAAAATTCGTTTCTCGGGCGAA
ATCGATACCAAAATTTAGTTCAAAATTTAACGTTTTAAACTTTCTTGTTATATTATCGATCGAGATATTTTGGTAAAAAAAATTTAAGTTTTCTCCTTAGCTTACCAACTAAGATTTAGT
TTGAAAGTTTATTCTTTTAACGAGTTGATTGTTTTGGACCTTCTTGTTATAATACCAATGAAGATTTTGGTAAAAATTACAAATTCAAATGCCCATGTAATTCTCCCGGGACATTTCTAG
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATCACACTATTGATATTACTCAATTAAGAG
AAATTTGGAAAGATAATTGGTAAATTATTTAAATAATTTAGACATTTGTGTAAATATAAATTGTAGGTAAGATTTGCAAGTTCTCATACATGATTTGAGAACTACAGGGAGGGAGAGGTA
AGAGTTTGGTATAGAATTTGGAGAGATCGCATATAATTTGAAAAAGTTATGTGAATCTCTACTTTAATTATGAGCAAAATAACATTGAGATTCTATATATATGATATATGTGTATGCTCT
CACGATGAAATCACAGACGTAAATAACACCAAAATTTAATATGTTTGAGTATTTTGGGTGAAATCACAAACATAATTAATTACTTGTTTTTGTTTTTATGTATGCATGTGATTTCATTCA
AACAAATGTTTAAATCTTATTTTAGTCTATAAATTTTGAACGTTGCTTTATATTTTGATCTCTAAACTTAAAAAAAATGTCNNNNNNNNNNNNNNNNNNNNNNNNNNCATTTACTTTATT
CACTAGAACGACCATGTAGCTTTGTTTTAAAAAATTAAAAATGAGTGGCATGTTGGGCGTTAACATTTAACAACTCGTGACGAGATAAAATAAACTAAAAATCAAATAAATGCAACTCAG
GTAGATAATACACTCTAAGAAATTGAAAATAAATATTCTCAGTACATGCAATGAATCCCATAACTTAAAAAATGAAGAAAAAATGATACGAGAAAAAAAAATGCATTCATGAATCACAAA
CTTAAGGGATAAAACACTTAAAATTTGAATGTTTTAGTATCTCCCACATGAGTTAGAAAATGTAGTAGAATGCCAATAACCAATTCACCAAAATAGTAAACGATTAAAATCTCATGACAA
TGTGACTTTTAAGTTCTTCCATTAAACATTCGTTCATCCTCTAACATTTAATTCAAAATTAAAACCCTAGATTTTTTTGTTAGATGGATGAGCTTAATTTGTGGTCAAGTCATCCAAATA
TACGAGAATCACCCTAATTCTCTTGAAAATTTTAGTATAAATATTATAACAACAACCAAAAAATATAAGCACTTTAAAGAATTGAGGGTTTAATTTTTTTTATAATGTTTAGGAATCAAA
ATAAAACAAATACAACAATTCGACTCCATACGAACTTTTAGATACGGTTTAGAGTAAGGAATTGAATATTGATGAGTAAAGAGTTATTAAATGTAAGAAGTTTTTAAGGTATAAAATCAA
TTTTGTTAATGATGGAGTCCACCAGCTCGTATAGAGGGCAACTTTCCTTCCAAAATTATGAATGAAACACACTCTCAAGCTTTTCCTTTTTAACAATTTTTTGTAATTTTTTTTCTTGAG
AAAAGCAAAGGCATTAGGAGGCGTGGCAGCCCCATGTGGGTTATCCTAAAGGTGACCTGAAATTATTTTTAAAACAATTCACCTTTCACTTTTATACAGAACTTACTCTTGTCTCTACTC
CAAATTATGTATAAAAAGGAAGCTAAGTCACCACTCCCATTCTCACCAACAATGATTAAAATGGATTCTTCTAACTCTCCACTATTCTTCCCATTGTTTTGCTTATTGGGTTTCCTGGTG
GGACACTCTTTGGCTCAACTAAACCCTTCATTTTACGCCAAAACATGTCCTAATTTACCTAATATTGTGAATGCTGTCGTTGCTAAGGCTCTGCAAACCGATGCTCGAGCTGGAGCCAAG
CTAATTCGTCTCCATTTTCATGACTGCTTTGTTGACGTATCCAACTAATTAACAACAAATCTCAGTTTCATTCTACATTTTTATGTTTTTTTTTTGCTGAAAACGAAAATTGATGTGAAA
TATGGGTAATATTGCAGGGGTGTGATGCGTCTGTTTTGCTAGAGAATGCACCAGGCATAGACAGTGAACTAGATGCCCCTGGAAATCAAGGCATTCAAGGTCTTAACATTGTCGATGACA
TCAAATCCGCTGTTGAAAAGGCTTGCCCTCGCACTGTCTCTTGTGCTGACATCTTAGCCATTGCCTCCAAAGAATCCGTCGTATTGGTAACTAANNNNNNNNNNNNNNNNNNNNNNNACC
CACTTTTATTTTTTTAAAAAAAGAGTATAAACAAAGTAGTTTTGAATTCAGGCTGGAGGGCCGAGCTGGGTTGTGCCATTAGGACGAAGAGACAGCAGAACAGCGAATAAAGAAGGAGCC
ACAAACAACCTCGCCAGTCCCTTTGAAGATCTCAATGCACTCAAAGCCAAATTTGGTGCTTTCGGTCTCAATTCCACTGATCTCGTGGCTTTGTCTGGTAAAATTAATACAAAATTAATT
AACCATTAACGGTCGGGGTTAAATAATCAAACTAATTATTGGGTTTAAATTCAGGAGCACATACATTTGGGCGTTCAAGGTGCGCATTTTTCAGCCAAAGATTCGACACGCCAGACCCAA
CGCTGGACCCAGCCTACAGAGAGCAGCTCAAAAGAATTTGCTCAAGTGGGTCAGAGACAAGAGCCAATTTTGATCCGACGACTCCAGACACATTTGACAAAAACTATTACACGAACCTTC
AAGGGCTAAGAGGACTTTTGGAGAGTGATCAAGTACTGTTCTCAACTAGTGGGGCTGACACGGTGGGGATTGTGAACCGGTTTGCCAAAAAGCAAGGCGAGTTTTTCAAAAGTTTTGGTC
AGTCTATGATCAAAATGGGAAATATTACTCCTTTAACCGGAAACAAAGGAGAGATTAGATTGAATTGTAGGAGGGTTAATCCAAGAAGGCCTAGAAGTACTGATGAAGGTCGTGATTTTA
TGTAACTTTGTTTAATTACTTGTGGTTTTGGATGGTTTTGTATGTCGTTGTTTTATGGTTTGTTCTTCAATAAAACTAAGTTATAAACGTAATAAGGGCGTAGGTGTCGAACTTAGATAT
TCGTTCATATTTTAATCTTTGGTTTGTGGCTAAACATTTTTGTTTAATTGTTTTGGAGATTTGTGCAGTTCCAAAGCCATGAACCCACCAAGAACCCACTAAGGCAACCTTAAAATTACA
AAATTTGATCCAACTTCCTCTTTACTTATTAATTAATTATTAAAACTTTAGCAATTACCTAATCGCAGCCTCGGATTTAAAGTGTCTTTTGGCCCTTTGCCACTCTAAATATTAAAATAG
TTACCATATATCATTATAATATATAAATTAATGTATCATTATCATCGTGGGTATAATCAAATGTAGCATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTCATTTGTGTGAATATTGAGGTCTCATTTGCTTGGGATCGAACCTTTTTCTTTGTTCTTTTTGTCACTCTCTGTAAATACCAAATAATG
GGCCTTATGATTTGCTCTTAATTTTAACTTGGCACTAGCTAATATTATATAGTCAAATACTGTATAGTTGTTCTTTTGTGTGCTACTGTGTTGATATTATTGTGTAGTAATTGATGAGTT
AATGTTGTATATTTTCTTGTAGGTATATTAGTTTGGTAGGAAGGTTTAAGGTTGGGTGAGAATTGAGAATGAAAAGATAATAAATTTAAAGATACCAAAGATATTAATTATAAAATTTAA
CTAATATCATTAGATTGAGAAAATTAAACAAACCAATCTCAGCCTTTGTTATCGAGACTAGATTGAAAAATCACACACTTAGTTATTGTTGCTTGTTGTATCGAAAATTAATATAAAAAA
GAACAACTACGGAAGGACATCATCAAACTGTTGGGGACACTATGCCCATAATAAGAGATTACATTAGTTGTGTAGTAATTGATCGTTACAATGTTTTATGATTGAGGATACAACACTTTA
AACATCGATCAACGTACTGATCATAGATTGACTCAACAATTAAAATTATATTGTACAATAACAGTTGTCATAACATTAATAAGGACATGTACAACTCGATCCCCTTAATCAATATTCACG
TAAAATCCTAACTTTAAATATTATTGAGTAACTTATTATTCTCTTAGTTTAGAATGTTGTATCGTCACACGTTAGTAGTTCTCGAAGGTGCATACTAAACCCTAACCACTCGTCTAAATA
TATTGCGAATCATTCATCCAAATAATCCTAAACTTAGAAATCCAATCTAAATCTCGGAAGGATGAGGATGATATCAAAACTCACAACAACACCAAACAATCTCAAAATCTCAATCTGAAT
GGNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGATGAATTGTGGAGAAAATTATAATGAGATGAAGAGTATAAATAGTCAAAATGATTAGAAGTAAATTAAAAGAAGGGAAGTTCGTGGA
TCCTTCGTGGCAATTTCTCCAATTTGTCCGACGCCATCCAACGGAGACTTCAAAACAACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGATGAGGATATGAGGATA
TGAATATTTGAAATTGGTAAAAATGGCACGTGGATTTTTGACAAAGTTGATCGGATTTAAATGGACTTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCTGCTTAA
ATTTTGCAAACTTTACTCACCCACTCCTCTTTTTTCTTTTTATTTCTCATAATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATTGAGTTTTGGGTAA
GGGCCTTAGATTACATTATCTAAATAAACAAAAATAATAGGATGGACTTTACAGGCAAATAACATAATATTTGGAATGTAAATCAAAGTTTTGAATCAGTCAAATTTACATATTTAAAAA
TAGAATATATCGAAGTCTATGTCTAAAATTTCAAATTTCAAGATTTTCTTTCCTTTTTTTCTTTTTAAAAAGTAAGGGTTGAATTTAAAATTTGAATAAATTTTCTTTTACTGACTTTTA
ACTCAACAAACAGCTATGCATACAAACATAAGAAAATGAACCATTTTTTAAAAAATAATTTACTTTTTCTAGAGAGAAAAATGGAGAAGATATCAAATTAAATGAGGTAATATTGGGTGT
ATTTTCTCACGACTCACGTAAAAATGTACTAAAGTATTTAAAATTTAATAGACTATTCAAAGATGGATAGTATAAACGAGGTGAGTAAGTAATATTCTTTTTGGTATAAAAGCTATATGG
ATGTGGACTATGGAGGGGGTTGTTAGGTAGCTATTTAGTACTATTTACATATATATAATAAAGTTTGAAAGAAGAAAACAAAGGAATGGTTTTCAGGTTTTGTTATAATATCCTTTGGAC
AATTCCTTTCTTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTGTTGTGGAAAAATGACAAGTTAAGATATTCCGATTAGGTATTTCACAACTCTCATAATATTCTTAACATCTATTT
CAATTCAAATAATATATATCCAAAACACACGTAAATATTAATCTACAATCTCAATCAGTGACTTATTTTTATACTAAAGAATTATCATAAAATTTAAAACTTAATTGAGTACTCCCTTGT
ATACATGCATCTATCTTTGTACAATTTAAATATAATCCAATAAAATGTTGTTTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTGTGATAGAGAAGTGGGGA
ATACATGTGATAAATACAGCTTAAGTTGTATTTAAACGTTGCTATGAAATTAGTAAAGATCATTATAAGGACTTTAAGACTCGTTCGATAACGTTTTTGTTTTTGTGTTCCTTGTTTCTA
TTACTCACCTGGGTGAGGCTTAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATAAACAAAAAGATTAAAGAAATAGTTACCAACCATAATTTTTGTTTCTTGTTCT
TTCAACATATTTATACATTCAAAATTTGAACAATTAAACTAACTAGTAAGCAGTGCAAATTGAAGTAAAGAAATACAAATAATTTAATGATAAGATTGCAATTACATGTATATAGGTAAC
CCAATACCAAACGAAAACCCTAATGTTGTATTCAAATTATTCATATTCAATTTTGTTAATGACCTTGAATCCATCGACAACTTGTGGCCCAAGCTCATGGCTGCTGTATAAATTAATCAA
ACCTCACCTCACCTCTCCAGTTCTCCACAACTTATTCTCACAAAACCAAAAGCCTTAGCAATGGCTTCCCCTAAACTTACACCCCTTGTTGCAGTGGTAGCTTTGATGCTTGCTCCCTCT
CTCGCTCAGCTTAACCCTTTCTTCTACACCTTCACTTGCCCTCAACTACCTTTCATTGTTCTAAATACAGTCTCTCAAGCTCTTCAAACCGATGACCGAGCTGCTGCCAAGCTCATTCGT
CTCCACTTCCATGACTGCTTTGCCAATGCACGTACTCATCATAAACCTACTTGAATTCATTTTTCTAACTACTTAAATACATTTTTTTTTTTAGTTAAACATCTTCTGATATATTGGATG
TTGGGTCATTTATGTAGGGGTGTGATGGATCTGTGCTATTGGAAGACGTACCTGGTGTTATCGACAGTGAATTGAACGCAGCTCCAAACAATGGAATCCAAGGGTTAGACATTGTGGACA
ACATCAAAGCAGCAGTTGAAAGCGCATGTCCAGGCGTTGTTTCTTGTGCTGACATATTAGCCCTCTCATCTCAAGTGTCTGTTGTGCTGGTAGGTATCGATGATTTCATCCTGTTATACT
TATAAATAAGTTAGGTAGCTCGTTTTACTATATTTGAAACTTATCTCTCTAATTAAAACAAGATTGTTAATTACTGCAATAGTCTGGAGGGCCAGCATGGATCGTCCCATTGGGAAGAAA
AGACAGCAGAATAGCAAATAGAGCCGCAGCTGCAAATCTGCCAAGTCCATTCGAAACTCTAGACGTGCTGAAATCCAAATTTGCAGCCTTCGGGATGAGTTCTACGGATCTTGTGACCCT
ATCGGGAGCGCACACATTCGGTCGAGCAAGATGTTTCTTCTTCACAGGACGGTTCGACAACTTCAACAACACTGGCGTACCCGACCCGACTCTAGACGCCGCATACAGGGAGCAGCTACG
CCAACTTTGTGCCACTCCAGTAACAAGAGTAAACTTTGATCCAACCACACCAGACACATTCGATAAAAACTATTACACTAATCTCCAAAACCATAAAGGGCTTCTCCAAAGTGATCAAGA
GCTTTTCTCAACCCCTGGGGCCGATACAATTGGCATTGTCAACACATTTGCTGCTAGTCAGCTTCTGTTCTTTATTCAATTTGGGAATTCCATGATCAAAATGGGGAATCTTGGCCCTCC
GCCTGGCACCCCATCTGAAGTCAGATTGAACTGCAGGAAGATCAACCCACCCACGACCTTCCATGATGTTATCTAACTAATTTAAACTTAAATTTACAGAAATAAACTTCAACTTTGTTG
TTGTGTTTGTTTACATGTTTGAATCCAGTTCATTAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTTCTTGTTAAATCAATGGATTAGGTGTTTGGAAGTT
TTCTTTTATTATTAAGTAGTGATGTAAAACAACAAAGTCAGAGGTTGGTTGCTCTGTTTCTCTCATATCACACAATAATAAGATAAAATACTATAATATTTATGGGAACATTCGTATTCA
AAATCCAAATTAATCTCCACTTGCTTTTCGTTAATAGTGTGTTTTTTAAAATTGAGGTGTTTGATTTTTTTAAAAAAGGTTGAAGTTTTTGGCCATCCCTCCCAATTTAGNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGACTAAGATAATCAAAATCCTACACGTTTACCTNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNANN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAAATATCAGCCCTCATATTAGCTTC
ATCTCTTTGTTCAACATTGATTAAGGCCTTTTTTTACCGAAACAATGGTGAATTTTCCGTCAGAGTTTAACTTCCACTTGGGGAGATAAGGACCTTTACTGTTATTTGGAGAGATAAAGG
GTTGTTTTAGGCTATCCCATTGCTGCCTTTCCAAGCTTTTTAACAGCCTTCTAGAAAAAATATCCCAGTCCGAAATGGTAGCCTTCCCAAGCATCTTTGATAGTTCCATCTTGGACAGTA
TAGAAAGAGCAAAAAGTCTTGGCTTGTGCAAATGACAGTATTTAAATCATATATAGGCTTGTGTAGAAAGAGCAAACGGGCCCAAAAAGTTGTCCTCCCAATGTCTCCTCTCTCGTTCTT
ACAAATATTTAAATCATATATTTTGTTTGGTATATGATTTCTTTTAAACTTAAAGGAGAGAACATGCAAATTGAATTACCATATAGTTCTTTTGGCAGGTGATGCATTATAGTATAAAAC
GTGTTCATTAATGTGAATTATGTAAACAAAAAAGTCAATCATATTTTGATCAAGTGATCGAAATTTGTAGGAATATATTGGATAATGGAAATCATAACAAGATTTATAATCGGCAAGATC
TTTGATTATCCATCAACATGCTTATGCACTTAAAACTTGAGCTATTAAACTAACTAGTACTGCAAATTGAAGTAAGAAATACAATTAATTTTAATGATAAGATTGCACTTATATTGTATA
TAGGTAGCCCAAATACCAAACGAAAACCCTGATGTGTTGAAAATAATCATACTCAATTTTGTTAATAATTTAATGTTAATGACCATGATCAATCGACTATATGTGCCCCAAACTCATGGC
TGCTGTGTATAAATTAATCAAACATCACCTCTCCATTTCTCCACAACTTACTCTCACAAATAACCCAAAAACATTAGCAATGGCTTCCTCTAAACTTACGGCCTTTGTTGTGGTAGCTTT
GATGCTTGCTCCCTCTCTGGCTCAGCTTAACAATTTATTCTACGCCTCGACTTGCCCTTAACTGACTGCTGTTGTTCTAAATACAGTCTATCAAGCTCTCCAAACAGATGATCGAGCTGC
TGCCAAGTTCATTCGTTTCCACTTTCATGACTGCTTTGCCAATGCACGTACTCATCATAAACCTATTTGAATTGATTTTTCTAACTACTTAAAAATACTTTTTTTTGTTTAGCCAAACAT
CTTCTCACTTCTTCCTATACGGAAGTATAAAGCAACACTTATACGTTGGATGTTGGGTCAATTTATGTAGAAGTGTGATGGATATGTGCTATTGGAAGACGTACCTGGTGTTATCGACAG
TGAATTGAACGCACCTCCCAACAATGGAATCCAAGGCCTAGACATCGTGACAACATCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACTAAACATCTTTATCCTTTTTGTAGCAATGTCATTTGGTAAAAAACTTGTAATTATCATAATATATACCTCGTTTCTTTTC
TTATTATAGTGTAGTAATTTCTTTTTCTCTTTCTCTTCTTTCCAACCTTACCCAACAAGTTTAGCTTTAGGCATGAAGAATTATCGTTACAAACNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNGTTCTCGAAGTCTTCATCAATCAATAAGTATGTATCGTCCTTCAATTTTAAAAGTAAACCTTTTTAGTACGTTTCACATTTTTTTAAAAAAATTAAGTAGAACTT
CAACTTATAAATGGATAGTAACCATATAATAATGAACTTAATTAGAAATTTTGATACCAACAGCCCTCAAAATTGGAATTCATAATTTTTTCTACTTTTAAGAGATTTTTTATTTCTATG
TCCAAAATGTCTAATAAATATAACTTTTAAACTACCAATCTTGTCATTTAAGATTTTTGACAATTCATGGATTTATTATTAATAGTCACAAAATTACAACAACACAATAATCTTGTAATT
TTATATTTGATGATCAATTCCNNNNNNNNNNNNNNNNNNNNNNGGAATCTCACAAAAAATCCAGTAGCCATCTCTTCACAAAAAAATTTGGGTATTTTAAAAGTTGAATCCCCAACAACT
TCATTTATTAAACAAAGAAACAATATAATCTTCCCGTTAAACTATGTGTACGTTGATGCATGCACACTGCTATACATCATGTGCATAATAAGATAGAAAAAGAAAATCGTACAAGGAGGC
AAATTTACTAGAATGGTCATTGAAAATATATATACACACACACAAGAAGACAAGCAATAATGGTATAAAACCAACCCAAGGCAGTACCAAATTTCAAAAAGAGAGAAAAAGAAAAGTCAT
ATTTTAATTGTGGGATAGAGTTGGATTATTGTATTGTTTAATTGAATCCCAAGTTGTTTGGTATACTAAAAATTAAAGGTGATGGGGTGTGTATAAAAGGAAGATATGTTTGCACAAAGT
TTCTTATCCCCAAAGCAAAGACCAGAGAAGACCCCATTTGCAGTATCAAAAATGGGTTTACCTAAAATGGCAGCCATTGTTGTGGTGGTGGCTTTGATGCTATCACCCTCTCAAGCCCAG
CTTTCTCCTTTCTTCTACGCCACCACATGCCCTCAGCTGCCTTTCGTTGTTCTCAACGTGGTTGCCCAAGCCCTACAGACTGATGACCGAGCTGCTGCTAAGCTCATTCGCCTCCATTTT
CATGATTGCTTTGTCAATGTATTATTTTATTTCATTTTCTTTTTTTTTCGTATTGCATAAACACATATCTAGTAAATGTTTTGTAACATGATGGATGAATCTACTCTTAATATTTTTTTG
GTTTTGTGTAGGGGTGTGATGGATCGATTCTATTGGTAGACGTACCGGGCGTTATCGATAGTGAACTTAATGGACCTCCAAATGGTGGAATCCAAGGAATGGACATTGTGGACAACATCA
AAGCAGCAGTTGAGAGTGCTTGTCCAGGAGTTGTTTCTTGCGCTGATATCTTAGCCATTTCATCTCAAATCTCTGTTTTCTTGGTAATTACTTTAATTAAATTTATGTTTCCTATTCTTT
CTATAAGTAGCTCAATTGAGATGCGGAGAATGCGATGAAATTAAAATCTCATACCCACTACATAAGCTAAGATGACAACTATTTTGAATGGTACAAAACATTTTTTTTAAAACCAAAAGT
AAAACCCTGCCTACTTTTGTAAAGATAAATGGAGATTTGTTATCTTCGGCAAGTAATAATGTTAACTTTTATGGTGTTTTGGCAGTCGGGAGGACCAATTTGGGTTGTACCAATGGGAAG
AAAAGACAGCAGAATAGCCAATAGAACTGGAACCTCAAACTTACCTGGTCCCTCAGAAACTCTAGTGGGACTTAAAGGCAAGTTTAAAGATCAAGGGCTTGATTCTACAGATCTCGTGGC
TCTATCAGGAGCCCACACGTTTGGAAAATCAAGATGCATGTTCTTCAGTGACCGCCTCATCAACTTCAACGGCACAGGAAGACCCGACACAACGCTTGACCCAATATACAGGGAGCAGCT
TCGAAGACTTTGTACTACTCAACAAACACGAGTAAATTTCGACCCAGTCACACCCACTAGATTTGACAAGACCTATTACAACAATTTGATTAGCTTAAGAGGGCTTCTCCAAAGCGACCA
AGAGCTCTTCTCAACTCCCAGAGCTGATACCACAGCCATTGTCAAAACTTTTGCTGCCAACGAACGTGCCTTCTTTAAACAATTTGTGAAATCAATGATCAAAATGGGCAACCTCAAGCC
TCCCCCTGGCATTGCATCAGAAGTTAGATTGGACTGTAAGAGGGTCAACCCAGTCAGAGCCTACGACGTTATGTAATAACTTTATCCCACTTCATCCCTTCTACTTTTGCTGTCTCTTGT
ACTACTTTGTTGATGTATTAGTTCAACCGGTTAAGATATATATATCGTTGACCTAAATAATAGAATTCTCTTTTACTGCATATCATTATTTAAAATATTTACAGTAAATTAGAGAAAATT
GTAAACTAAAACAATAACAACAAACAAGAGATGAGGAGATTTAATATATGAGGTAAAATGGGTTGGCGTTGAAAGTTCAAAGTTTTAAGTATTAGCAGCCGCCCCCTCATCCCCAATAAT
CTTACCCACCACAAAGCATCCCGCCCCTTGCGTTTATTCATTATGAAAGCGACGAGTAAGCCCCCCCTTTTCTCATGAGTATCATTAATGTCACACACATCTATAAATTTTAGATGAGAT
TGTTGGGTATATAATTAATTAATTGAATATTGACACGTTAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGAGAAGGCTATAACTTTGAAAATAGCCTTTTATGGNNNNNNNNNNNNNN
NNNNNNNNNNNNGAACAAAAACAAAGTAGGTCATTCAATATTGAGGTAAATAGTTTTGGTGGTCAGAGTTCAAAGTTTTACAATTGGACTCCTCTTCAATTCCCACTGCAAAGCAGCCCC
CCTTGCATTTATTTATTATCAAACTAGCTAACAAGTGATCAAGCTTGTTTAGCATTTTTATTGGACAAAACTATCCTAAGTTACAGGGTTTGATCCATAACTTNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTAATGTCTCTAACACATTTTGTAAAATTGAAAAGTTTTAAAGTTTGAATGAGATTTAAAATTTCTGTGGATGATAATTTAAGA
GTGGTTTAGGTACATTATTCTCAAAGTTAAAAGAAAAAAAGGCATAGCTTTTGGTAGACTTTTTTGGATGATTTTACCGACACTCTTTCCCTTCTATGAGCTGCCATGTAAAGTCAATCA
AATCAGAGGAAATAATTTATCTAAAAACATTAAGGACCCCTTTCCAAAGTGAACATTGTATCCCCTATCCAGGGGGTTAATGAAAATTGAGAGAATATAAAGAAATGTACTATAGAAAGA
TCGACACATAGATCTATATATACATTGTTAACTAATAATGCACGACTGTCTTAGATAGACTGTTTTAGGTACAAATGACGTTATTTTGTTAGTGAATTTAGTTATATATTGCATGTCTCT
AAACTTTGAACAAACCTACAACTTGGTTGTTCACAGAGTGCCGACTAAATAATTCGAGATATTTTTTCAACAACTGTTTTTCTTAAGTTTACTCCAAGTTTATTTTTTTCACTAAAAAAA
AGTTAATCTCTTTAGAGTTATAAAACAAATGTGAAAAAGGCAAAGAAAAATGAGGATGGATGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCATCCAAGTTTTTAGTTTGATTT
TAATATAACAATTTTATCATTAAGTTTTAAGTTGTTTTAATTTGGTTTTTAGAGTTTTGATGTCTTGTAATATCCATTTTTTTACTAAATATTCACTTCAAAATTCACGGTTAATAATAT
TAACTATCGATGTTTTTACTAAATATTCATGATTAATAATATTAATGGATCTAAAATACTTATGACGCACAATTTTGAGATCAATTTTAATAGCTATCNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTAGATAGTAAGAGAGTTGATAAAAACTAATATGAAATTTTGTTAGGGTAATTTTTGGAT
GGAAAGTTGATTTTGTAAAGGATAAAAAGTAAAAAAAGTGAGACGTGATCTAATTGAATATGACTTACTTTATAGAGAGTTTGAATTGGCAGAGTCTCTCACGTGGGGAACCATTTTCCC
CTAATACCATAAATAAATTCCTTCAATAACATATTCAACCACACAACTAAGTTACCATTTCCTTAATTAATATTATTATGTGCAACTCCAATATGGTATTCAAACTTTGCCTTCTTTCTC
CACTCAAAAGCATCTTCTACTTCATTTCAATACTTCAATCCAAGATTCTCTTAGGCTGCTCATTATTATTTCCAACTCCTTTTCCAATTATTTCCAACTCCAATATTCCATTCAATAGAT
TCTAAATATTACCAAACACGCCAAATAAAAACCTTACTTTTCAGTAGCTGTTTTCAAACTTAATAACCCTTATTCAAGCATTTGGGTTGGGTCGGGTCGGATTGGTTCCGACTAATTTTA
ATCAACAAAATTATGAAACATGATTCTTCCATAATGTGATCATTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAATCATGGACACTTGCCCTAAAATATCCTCTTTCGTCTATCC
ACTGTTTTGAATCAGTCCTCTTCCATTCTTCATTCAATATCCCTATAAAAAGATGCTTCATTTGTGGTTGTTTCATCACCAAACAAGATGGGTTCCTTCAGTTTCTTCCTTTCGTTTCTT
TGTGTTTTCTTTGTAACCTCTTATGCCCAACTCACTGAGAATTTCTACGACCAAACTTGCCCTCGTCTCCCTAACATTGTCCGCCGTGAAGTCAAAAGAGCTATCGAAACTGATATTCGT
GCTGGTGCTAAACTCATTCGCTTCCATTTCCACGATTGTTTCGTCCAAGTAACTATTCTTCCTTACTTCATTTACTTCCCTTTCCTATGCCATATGTTTTTACAATGGGGTTCATTTTGT
AGGGCTGCGATGGGTCTGTTTTGCTAGAGGATCCTCCTGGCTTCGAGACCGAGCTCAACGGACTTGGAAACTTAGGAATCCAAGGAATCGAGATTATCGACGCTATCAAAGCTGCCGTCG
AGATAGAATGCCCTGGCGTTGTCTCCTGTGCCGACATCCTAGCTCAAGCCTCTAAGGACTCTGTCGACGTGGTAATCATCATTCCCCCCCATTTCAATCTTCAAAATCAACAATAAAAAA
AAAGTACACTAATATTTGGGATTTTCTTTTCTGTGTTTGGTGAATCAGCAAGGAGGACCCAGTTGGAGAGTTCTATACGGAAGAAGAGATAGCAGAACAGCCAATAAAACAGGGGCTGAT
AACCTCCCAAGCCCCTTCGAAAATCTTGACCCACTCGTAAAAAAATTTGCAGACGTTGGTTTAAATGAAACCGACCTTGTTGCTCTATCAGGGGCACATACGTTTGGTCGGTCCAGATGC
GTGTTCTTCAGTGGTCGTTTGTCCAACTTCAGTGGCAGTGGGCAACCAGATCCAACGCTGGATCCAACTTACAGGCAAGAACTTCTAAGCGCTTGTACAAGCCAAGACACACGAGTGAAT
TTCGATCCAACAACACCTGATAAATTTGATAAGAATTACTTCACCAATCTTCGAGCCAATAAAGGGCTGTTACAGAGTGACCAAGTTCTGCATTCAACGCAAGGGGCTAAAACAGTTGAA
ATTGTTAGACTTATGGCGTTGAAACAAGAAACTTTCTTTAGACAATTTCGGTTGTCGATGATTAAGATGGGGAACATTAAACCATTAACTGGAAGCCAAGGGGAAATTAGAAGAAACTGC
AGGAGGGTTAATGACTTGGGAAGTGAAACAGGGCATGATGTTATGTAAATTTTGTCTTCCCTCTTACGTTTGTTTGTTTCTCTCTTCCACTTCCATCTCCTTTCTATAATAAATTAGCTC
CACTACATCACCTCACTCAACTCATTCTCATTACTTTCTCATCATCGACTCTTCATGTCTTCTTAATTAATCTCACTGATTTTACACTCCTCAACTTCTCTCCATAATGTAATCAAAATA
TCTAATTCTTAACAGTGTGAACAGAGAGAGAAAGTATGGCATCGTACAAGTAGCCTTTTATTATTTGTCTACTTATTTGGTGCATCCCTGAATTTCTTCCTGCGCTACAATAAATGATTG
ATGGGTTGAGTGTCCAAATATAATTAAGAATTTCCAACTTAGGATGACCCACATGAGAGTAGACATCTACTTTTGGATGAGATGAGGAGAAAATAAAGAGGTGGATTCGGTAATAGCCAA
GTAAAGTTTGATTTATTGAAAGCTACATTTATTCAGTTGTGTTACAACTAACAACTGATGAAATTGGAGATTATTTAGTGATTACCAAAAATGTTAATGTTAATAATCATTATTTTTTCC
TCTAACTAATTAATTAACTTGGTGATATGTAATTAATTGGGAGTTAAGTAATATTTTTTTAAAAATGGGCAGTAGAAAATTTAATTGGGTGGAAAATATCTAAGTTTGTTATCCTTTTGT
TCTTTTTGTCATTTAATCACTTGAGTATGGACCCAAAAAAATATATAATTTTCTTTGGACAAACCTCTAATTTGTTGTTTTACTAACAAAAACGGACAACGAATATTCGAGGAAGCTAGT
GTATTGAAATATATGATTCAATATACATTTATGAAAAATGAATTATTTTGATCAGTATTTATATATGTTGAGGACCAAGAGAGATGTAGTTCAAGTTACTTTTTACTTTTATTTTACACC
TAACAAAATAGAATAATACGCCGATTTTCTTGTATAAGTGTTGTAATTTTAACCTAATTGATTTACTTTTAAAAAAAATGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNTCAACNNNNNNNNNNNNNNNNNNNNNNNNNGAGAGGAAAAAAGGAACAATATAATTTTTCATAAAATCAATAATTTTACTAAAAAGAAAAGATTGGT
CTAAATAAATAGCTTTAAACTTGTTTTTCCGTAGAGAAATTATTAATTTCACATCATATAAATAGGTTAGGATTAATATACATATAGTAAGGTCGAGTAAAAGTTTCACTTCTCCATTTC
ATGGATTGTTAAAGTTTAAAGTAAAAATTACAACATTAGTCTAAATTTAATGAAATTGAAAGGTTTGATAAGTCTAAATTTGCGATTACAAATTTGAGATCAAAATTGATTTTTCTCCAA
TGACTCATTGACACGTTGCATCTAAAGATAAAAGTAATTATTGGAGAAGAAACAAAACTATGGTTCTTACCCTTTAACTAGTAATTTTCATCATAAACATTTTAACTTTTGTTTGATTTA
AAATACATTATTGTAANNNNNNNNNNNNNNNNNNNNNCAAAAGAGAGATTCTATACTTCCATAACTAGGCATTTGCATTTTCTTATCTAATTTAAAATTTTAAATGCCATTCATATTTTC
AAAGAAAAAGCATTATTTCCAAAGCTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATCATTTGACCAATATGATATAAAATAGATGTGAAATAGATAGATATTGNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATATCCAATTCAACTCTAATATTGCAACGTATGTATGTGAAAATAAATAAACAAATTAGTGGTTTTGGATTTAG
ATTCAACGTAGAAGTTAGCACACTTGAAAATAAATTGATATATATTTCTCCAATCTATTTTATCAATTTCACAACTTCATTTATTTTCACTACATAAAAGGGACACGTATGGCTCACACG
TGTGTATGTGTATATGTATAGGAAAAAAAAAAGTTGACATAAATAACTTTTAAAAGATAGATAATATTATTTTATCCCAAAATGGGAAAGAAAAAAAGATAAAGAGGAAACTTGGCCATC
AAGGAAGAAAAAAAAGGGAAGAGTAGGTGTAAATTTGTTTAGTTTTCAAAATCTATTCATTTAATTTCTTATTTTAGAATGGGTGTCGAATTTTGGTGAAAACAAGAATATGATTATGAT
TTAGGTGAAGATTAACCTAAACATAATGAATTTAATATTACAATTTAGACTGATGAAGACGTTTAATTCAAACGTGAATTTTGAATTATGTTACATTCCATTTCTTTTTTTTTTTTGTAA
TAATTTGATTCTCGAAAGGAATTGAATGATTAGGATAGGGTTGGATTTTATGAATTGAAAGTTAACCTAACTCTAGGTTGTGAAAGTTTGGGGAAGGTGNNNNNNNNNNNNNNNNNNNNN
NCTAGTCATGATCTATCATACAATTAATTACTCCCCATTGAAAACGAAGTAAAGGAACTCATCTCTTTTGACTAAGTAATTTCTTAGGTGAATTGTAGTTTACACTTCAACTACTTATAG
TAAGTATCATATACACTAATTAAAGTCAGTCATGATCCTTAATTAGATTGTTGAATAATAATTTTCAAAGATGTGTTGTGCTATTTTAACTTTCCTATGTTTCATCATACCCTAGTTAGC
CATGTTAATTACATTTAAACATATATTCATTTATAAATGAAAACAATAAGAAATTGTGGTTCTCTCAACCACAAATCATTCAATGGTGTTTGGTGAATACATGTAAAAATGATGATAAAT
AATCATGATTGAATAAAAGTAGGTGGAAAACAGTATAACTATTATTATTAAGTTTAATGTGATTGAATAGTTTATAGTTAATAATAATTAATCCTGTTGCGAGCGGCGAATTGGAAAAGT
CTTGAATTCAACGAACAGATGTTACATGTAGAACCCAACCATATTTAATTCAATGTGGTTGTTTTTCTGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTGCGTGTGAAACT
CACACTCGCTTGTCGTCGTTGTAGGGGCTTGTCCACCATCTAGCCAACCTGTTTCTTTTGTCATGAACTCACATTTTGAGTTGACATGCATCTAAAATTTCTAAATCAATATAGGAAGTG
TATATAGCTAGCTAGATGTGCAAAAGCAAGATAAACTATGACTCTCTACTTGTAAGATTTACTTACTTTATTTCTTTGAGATCGTTGAATGAAACTGTTTATAATGCATTTATTTTAACA
TTTCTTCGTGGTTTTGTGTAGTTCAATAGATGTTAAGGTAGTTTAATTTTTTACCCTTGAGATTGTAAGGCATTGTACCAAGCCTTTCCTTAGAGCATCGTTGGTTAGCTCAAAATTTGA
GATAATTCTTTTTCTTTTTTTTCTCTTTTAGGGATTAAGTGTTTGTTCTCATAACTCTTCTTATTTTTCTTTAGGTTTGGTGATTTCACCCGTAAAATTTGAACTTTGCGTGGTGAACCT
AATAATTTATACAATAAAATTTCAATGTTTTCACCTCGATTAAAACAATTATTGTTGGTTGGTTCATAGATAAAAACAAGTGGTAAAAACGAGGAGAACATAACTTTTTTGTTTTATTTT
TGTCACAAAAATAAATTTGATAGCTTATTTTAAAAGTCCTTGTACTTAGAACATTAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAGATCCANNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATCCACGTTCTTATAATATAAAATCTTTTCTTTTAAAAAATGCAATAGAAAAATAATTT
AGAAATCTTTATTCAAACAAATCCCCCAATGACAATAAAAAATACTTGATGGAATGAATTTCCATTTAAACAATCGTCCAACATGTATTGATATATAATAAATCTATAAACTATAAAAAC
TATACAACATTTATCAAACGACTTCATATATTTCTTATGAGATAAAATAAACTATCCTTCTTATTGTCAATTGATTAAGAAGAATGAAATGTTATATCATCTTATCGATACGGTGTAAAC
TCACTCAAACATTAAGAATGATGTATTCAAAATAAACGTTATTGTTGGTAATCGCCACGAACACAACGGTAAAGAGAAGTTTAACCTTATAAACAAAACATCATCCTCAAGTTTGGTAAC
TTTGAATTTTTTCTAAAGAAAAGAATTAATACATAGTAATAAAAAATGAATTAAAAGATTCGTTTTGCTAAACTTTGTTTCAGTGGTAATTTCTAAGAAATCAAACGTGAAGGATATAAT
AAATTATTGACCAAATTTCCCCTCGGGGGCCCTCAATTTAACCTAACTAATTAACACTAACATATATATATGTGTGTGTTCATCACACGCCCTAAGGTAATGAAATACAATAATATAGTC
TCATGGTCACCACATGCCTAAGTTGAATAAATAATTAAACTAAGGTGTCTCCATCAACTCTGCTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNCTTGATTATTTTAGTTGTTTTTTCTAGAAAACAGGCTAAACCCAAAATCAAACTTGGCTGGTAGAGAATAAATAAATAAATGGGAGTGATAAATGGCT
TTTACTCNNNNNNNNNNNNNNNNNNNNNNNGAAAGAAGGAAGAAGAAGGAAAGCATATTCTGAATAAGAAAAAAGAAAACAAATGAACAGCTATCTTTAAATTAAAATTGAATTTCTTAG
TCTCTTATTAAGACTGATCAGATTGTGTTAGGTCATACACTACCCCCACATTGATGATGAGATTGAGAACCCTTGAATTAGGGTTTGAAAAGTTATTCATCACACACGTTTTTCTAACAT
ACTATTGCTTCATCAAGATAACCATACTTAAAGCTATGAAATAATCTTATTCAAATGTGATGTTTAAGTTGATTCATGTCTTTTTAAAAAGTTAATTATGAGGGGATTTTAGTTAAAAAG
AAAAAAGAAAAGGGATAGAAAGGAGCCAAAATTGAACAGAACATTAAATAAGGAGAAGAAAAAATTAAAAGAGATGAAGGTTGATGGTATCATTATTCTGATATACATCCAATGAAGCCG
TATTTGGTCCACACCCGCCCGCCACTCTAATTACTTATTCCTATCTATTATTATTCTTTCACCTTCATAGCTTCATCAAATTTCGTATAATTCTAATAAAATTTTGATTCAATCATTTGT
AATGAGGTTGAACTATGAATTATGAATTTAACGATGGTTAGAAGTGATCAAATTGGAGTCCAATTTGTTTTGAATCCATTTATGTGTTTATATAAAGTATGCATATTCATCCATAAATTT
TTAAAAAATCAAGGGGTTTGTCCAGCATTGAATTTGATTAGTACATAAAGGACCCTCAATAAACCCCACCAAAACATAAAAAAATTTCAATAATTAAATCCAACTCCAATCTGATATCAT
ATTTCTTGAAATCCTATCAATTCCATAAATTTACCCTAAAACTATAATTAAATTGAAAAGACTTTGTTGAATTAATTTTAACCTTTTCTATTATATTGAATATATATTCAAGATTATGAT
ATAGATTGGCATTCTTCATGATAAATGAAATTTTGAAATGTAAAGATATGTTTGGTTAAAAAAAAATAAGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAAGAGGGATAAATTGTCAA
ACCCTAAACCTAACTCAACCTAGAAATTGTATTTAAAAAAGTTGAATATAATAACTACAAACTTATAACTTATTAGATGTGGACAAACAAATGTGATTTCATTTCATATATGATATCTTT
TGTATTTTTTCTCAAGCCAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAATTACGTTTTGAACCTTTTTTTTTTAATATAGTTTATTGTATCTCTTTTCACTTTTGCTATTTTTGT
TCTTCACTCAATCTTTTCTATAATATTTTTTAAGATAAGTCTATAGTTTTCTTAGAACTTCCAAACTCTTTACCCTTTATTATTCTAATATCTTCTGCATGAAGTGTAGTGATCTCAAAT
GGACAAAAACCATCACTCCTATTCAACTTTACTTTAGTTCTAAAAAAAAACAAATTTTGTTTACCAATATTTTCTGTTGGTATGTAGCATTGATAAACAGTGNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNGAATGTCCAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTATGTGATAAACTAGATTTGTCCGAATATAG
ATTGTGATAGTAAAATTGCCCCAAAGAAAAATATGGTTGGAAGTGTAGTTGAAATGAAAAAAGTTGGAAATATGAGAAATGGAATGGGAGAGTAGTAAAGGAAGAAGTGATGATAATCAT
CATCCTTGTCTCCCACATGAACATCAATGCTACTTAGTTTACCAAAATTGGAAAATAAACAAAATGGGAATTAATTAGATTGTATTAGTAAAATTTCACTTTTTTTTTTTTAAACATTTT
AAATTTCAAAGATCACATTGGGATGAATTAGAAATTTAATGTGAATGGAAGCAAGATTAATAGGATTAGAAATGCAAAATTTGAAAAAGAGATGAATATTATTGGTATGAATTAGAAGTT
AGAAGAAGGGATGAAATGTTGAATATCAGCCGCCGGCATGCCCCACTCTGCTTTACCGATCTCTATAAAAACAGCTTCCATTGCTTAACATTTTGCTCACTACAAAATTCAAAAATGGCC
TCCTCCTCCGCCAACGCTGTCATCTCCTCCTTTTTCTTTCTATCTCTTCTCATCGGCGGCTCTTTCGCTCAACTCTCCGAAACCTTTTACGATCAAACCTGCCCTCGTTTGGCCAACGTT
GTGCGCGCCTCCGTCAAGAAAGCCATCGAAAGCGACATCCGTGCGGGTGCTAAACTTATTCGTCTCCATTTCCACGATTGCTTCGTCAATGTACAAAACTCTACACTTTTTCATTAATCT
CTCTGTTCTGTTTTGTTTTTAATTTCATGGGGTTGTTGATTTTGTAGGGATGCGATGGCTCTGTTTTGCTAGAGGATGCTCCCGGCATAGTCAGTGAGCTTAACTCACCTGGAAATCAAG
GAATCCAAGGGCTTGAAATTGTCGACGCCATTAAAGCCGACGTCGAAAGAGAATGCCCTGGCATCGTCTCCTGTGCTGACATCCTAGCTCAGGCTTCTAAAGACTCTGTCGATGTGGTAA
ATATTTTTGATCCAATACATTCGTATCGTTTAGCTCATCGCCATGCTTTAAATCTGTTACTGCTGCTTTGAAGCAGCATGACCAAGTCAAAATCTTGCTATTCCAAACTCGTATTTGACA
TATTTATATTATATACGTAAAAATAAAAAATGTTCGTAAGTGTAGAAATCTTTGTGTTGAATTTTTTATTGCTTACTAACGTTTGATCTCATTATCAGCAAGGAGGGCCTAGCTGGAGAG
TGTTATACGGAAGACGAGACAGCAGAATAGCAAACAAAACAGGGGCCGACAGTAACTTGGCTAGTCCCTTCGAAACTCTAGACCAACTTAAAGCTAAATTTAGGAATGTTGGGCTCAATA
CCATGGATCTCGTCTCTTTATCTGGTAAAATTAATTAACAAACAAATGAATTTAGCAGTAAATGAATTGATGGAAGTGTGGTTAGATTGATGAAACAAATTTCAGGGGCGCATACATTTG
GACGATCGAGATGCAGATTCTTCAGCCACCGATTTGCGAATTTCAACAATACAGGAAGGCCAGACCAATCATTGAACCCAGACTACAGGAGCTTTCTTGAAGGGGTTTGTTCAGCAGGAG
CAGACACAAGAGCGAATTTCGATCCAGTAACACCGGATGTGTTTGACAAAAATTACTACACAAATCTTCAAGTGGGGAAGGGGCTTTTGCAGAGCGATCAAGAGCTGTTCTCAACACCTG
GAGCTGACACCATCGCCATTGTTAACAGCTTTGCAGAAAGAGAAGGAACATTCTTCAAGGAGTTCAGACAGTCGATGATCAATATGGGAAATATAAAGCCATTGACTGGTGGACAAGGGG
AAATTAGAAGAAACTGCAGGAGGGTTAATTCAAACTCTGGTTTGTTGGGTGGAGAAGGAGAAGGATCAGAAGGCCACGATGTTATGTAAAACTAAAAAAATGAGCTGCCTGTTTCTGCAT
ATGTGGTGTTCATCATATCCATAACTTATAATTAAGCATAATGTGTGTGTTAATTTAGTTGGGTGTTTGTGCTTTCTTCCATGAATAAAACTGCAGGGGTAGGCTCATCTTTTGTTTTGT
TTTCATGGATTCATCTTCGTCTTTTTCTATATTAATTAAGCTTATTGTGTTGTCGGGTGAGTTCAATACACAGGTTAATAAACGTATCTAAAGAAGATGATGAATGGAGGATATAGTTTT
ATTTTTTATTTCAACTTTGCAGTCTTTTTATATTAGTCAATATGCAACAACCAGATGACAATAATGGAGAAAGAAGGAAAGTCATTTAGTAGCGAAATATGTAGAAGATAGCGTTCATTA
CGAAGAACAAACGCTGTTTTCAAATCCTAAAAAACCTCCAACCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAATCAAACCTATTAGAGAAACCCATTATAC
ATACTCAATTTTATGTTAGTTGAACGATGTTCATCTTGGCATCAAAAAAATATATTTTTCTATTACATATGAAATTCATATGCACTAAAACAAGTACCTTACATTATGTTTAATCNNNNN
NNNNNNNNNNNNNNNNGTTGTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTATCTAATTGATTAAGT
ATATGATTTTTTTTTTTAAATAGCAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCATCCCAATTAATATACCGTGGCATCCTACTTTACACCATATTGTCATTCCAAACAAAATACGGTTGT
AATATAGTAAGTTCAAATTCTTCATAATCTTTTAGTTTTAATACTTTTCAATCTATGTAAATGTTTTATAATAAACTTATCCAAAATCGATTTAAAAAAATTAAAACTCGTACAATGGTA
ATACGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGGAATCCACCACCTTCTTTATATATATAAGTCAGTGGCAGTGGTGAAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNGAAATTCAAATCACAAATTTAAATAACTATATCTATTTGTGCTCAAAAGAAGAAGAAAAAAAAAAAGTTAATGTGAGGCTATAAATAGCCAAAGT
CAATATTGGATAAATATAAATAATGAACGTTATATTGACTCAAATTATTAATAATAAGAAAGTCACAAATTGGGATTAACTTATAAAATTGAATCTTATGCTTAAACATTAATATCAAAA
TACATAGTTGGTTTTGCTTATGCAGCCTCCGCCAAATCCCACTCTGTTTTGGTCTCTATAAAAGCAGCATCCACTCCTCAACCTTTTGCTCACTTCCTAATTCAACCATGGCCTCTGCCG
TTGCCTCCTTTTTCTTTCTTGCCCTTCTCTTCCGCTCCTCTTTTGCTCAACTCTCCGAAACCTATTACGATCAAACCTGCCCTCGTCTCCCCAACATTGTCCGTGCCTCCGTCAAGAAAG
CCATCCAATCCGACATACGTGCCGGTGCTAAACTCATTCGCCTCCATTTCCATGATTGCTTCGTCAATGTACAAAAACTCTACACTTTTTCACCATCATCATCATCATCTCTCTCTTTTT
TTCTACTTTTAATTGTATGGAGATTTAACTTATTTTGTAGGGATGCGATGGCTCTGTTTTGCTAGAGGATGCTCCTGGCATAGTCAGTGAGCTTAACTCACCTGGAAATCAAGGAATCCA
AGGACTTGAAATTGTTGACGCCATTAAAACGGATGTCGAAAAAGAATGCCCCGGCATCGTCTCCTGTGCTGACATCCTAGCTCAAGCTTCCAAGGACTCTGTCGATGTGGTAAATAAATA
TATTTATTCGATTACAGTACTCTTCTTCTTTCTTTTGTTAAATGGGTATTCTTTGTTTCCCTTTTGTCAGCAAGGAGGGCCTAGCTGGAGAGTTTTATACGGAAGAAGAGATAGCAGAAT
CGCTAACAAAACAGGGGCGGATAGTGGGTTAGCCAGTCCCTTCGAAACTCTAGATGAACTCAAAGCCAAATTTGCTGCTGTTGGGCTGGATAGCACTGATCTCGTCGCTTTATCTGGTAA
AATGAAATGGATGAATTGAGCAGTAAATCAATTGATGGAATTGTGAGTAATTAATTTGATGGACAGGGGCGCATACATTTGGACGATCGAGATGCGTATTCTTCAGCCACCGATTTGCGA
ATTTCAACGGAACTGGAAGCCCCGACCCATCACTGGATTCGAACTACAGGCAATTCCTTGAAGGGGTTTGTTCAGCAGGAGCAAACACAAGAGCCAATTTCGACCCGGTAACACCAGATG
TGTTCGACAAAAATTACTACACGAATCTTCAAGTGGGGAAGGGACTTTTACAGAGCGATCAAGAGCTGTTCTCTACTCCTGGGGCTGACACCATCGCCATTGTCAACAGCTTCGCTGCCA
GAGAAGGAACATTCTTCAAGGAGTTCCGGAAGTCAATGATCAATATGGGAAATATTAAACCTTTGACTGGAAAGCGTGGGGAAATTAGAAGAAACTGTAGAAGGGTTAATTCCAACTCTG
GATTGTTCGGTGAAGAAGAAGAAGAAGAAGGCCATGATGTCATGTAAACATAATTCTGTGCTGCTGCCTGCTTCTGCTTCTTCATCTTCCTTCATTACGTCCATAACTATAATTAAGCTT
AGTTTATAATTATGTGTGTTAATTAGTGTTTATTTTTACCTAATACTTATTTTTATGTGCTTTTAATTGTCCTCATGTCATCATAAAATAAAGAAAAAAGAGATTGATTTCAAATTACAA
GTGGAACTCATACGTTCTTAGATTTGTTACTTTAAATTTAATATTCTATCTAGTGAATTATTTATCTATCTTAAAGTAATTAAACATAATTTCAAAGTAAATTATTGGTATCTATCTATT
ATTTTCATTGATTACAAAATTAAATTTGTACAATAAGATTATATCATTTCAACTTTATATGTTTAATATGTTAACCACTTAAGATGTTTGAGCTATGCTCATGAAGTGTTATCATTATAT
GGTTAACAATCAATGTTAACATGAGTTTAATTATGGTAAAAAGAATAATTATTGGTGAGGAGAATGAATTTAGTTAGGTTTTAAAATAGGAAATAGTAAGAACATCTATCATTTTAAATA
GATTTGTAGTTGTAAGAGATAAAACTTGATTTGTTTGACTTGGATTTGGTCTAATGGCTACAACTTGAATAGGTTGATGATCATTTGGAGTTGGTAGTTCAAATGCCTCTATGAGTATTT
GAAAACGAAAAATACTAATTGTCATGATGATATGAATGAGTAATGGTGTTTTAAATAATGAACTTAATTGACTAAAGAATTGAGCTTAATTAATAAAACAAAAGTTACAAATTGCGCACT
AATCAAATTGAATCTTATACTAAAACATACATTAAAAAAAAAAAAAGTTGCATCTTCCAAACATGTAATGCAAGGTCCATGGCAATTCATCGATTTAATTTGAAAAAAAGAAAAAGAAAA
AACCAAACGAGATATTAATCACTAATTTCTTTAAATTAACATGAACAAATTTCTATACTAAACTTTTGAGCTTGTGATATGAGTTGTTGATTATGATTGTATTGCATAACTATAATTGTT
ATTTAGTAATATTTTCTAAAAAATACAAATATATAGCAAAATGGGTGAAAATGTATTAACCATAAATCTTAATTAGGTTTTGGTTTAAGAATGAGAAAAGGCTGAATTTGATTGAATTGG
ATCGTTGTATTGTACATAGTCTCACTACATGGGCCGACTTGGGCCCATAAAAGCCCTCTTTGTCCTCTGCTTTTTGTTTTTAAATATTTAACAATTTAATTGAACAAAATTTTCAAAATA
TTTACAAATATCATATGACTATACATCTAAACTTCTATATTTGTGTCTATCATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAACACACGTTATCTAAATAGATACTGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTCTATTTTAAATTTTTAACCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATTTTATTTTTCATGTAATATTAATCTTTCATCAATAAATTTTTGAAAGATTGTATTTTGTAATATTAAATTTAAGACAACAAAT
AATCAACATCTTACCAACTTAGATACTATTTAGTCCTAATACATATTTAGGTGCTGACAACACTTATGTTAGTGGCAGCTCACCAATTCCACGTCATTAGAGNNNNNNNNNNNNNNNNNN
NNNNCACCTTATCCAGATTTGAATAACGACCTAATGAGATTGAGTAACTTAAATGGCAAGATACACGAAATAGGTTAATTTTGTGATATCCTCAATTTGTATGAGATTATTGTCGGAGAT
ATATCGACATACAATCAAAATCAATGATTACTCGATCCACGTTTTCAACGATAATAGATAATTTTTTAAATTCTTTCGGTTATTCAAAAACATTCTAAAATCTAGATTATTGAAATTTGA
AGATTTTGTATAGAATAGCGACTTATAATGAAAAAAAAAAAAGTAAATGTAGACTAGATTTTTACTTGTCTATGAATCCATTCATGGTTGACTAATTAGTTTATGAAGAATATGGCCCAG
TGCCCTTCTCTTCATGTTAATAATTACTACCTAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATAACAAGGGAGAGAGGAGTATGAGATTAAGCTTTCTTCACTTTAAAC
CCTAAGTTGACAATAGTTCTAAATAGTAAAAAATAAAACAAAGTATCAACCAAAAGAGGATTAAAATCTTGTATTCTTTTTCTCCTCAAAAGTTCTAATTGACGTTATAATTATTTTTAA
GTTTTGCATGGATGTTCACGTTGACATAAAAGATAAATGTTAGAGGTGAAAAAAATATTAAGTTATCTCAAAACAAATCAACAAATAGAGAAATAACTCATGTAGCCTAATTGTAAACCG
AACTTAACCCAACCCATGAGATATTTAGCTTAGGTTGGTTTAATTTAGGTTTTTCAAGATAGTTAGATCTATCTCTTACTCGTACGAGACTATCTCTTTTGTCTTATGTATAAAGAGAAT
GCAAATTTTTTTAGCTTTTTCAAGGTGGAATTTTCAACGACTTGGAAAAAATGATAAAAAGAGCATGAGCGTAGAAGAGAGTTGTATAGAAAAGTGTGTTTCTCTTCTTCTTATTACCTT
TTAGTTTCATAGTTTCATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGACAAAAGTATAGTATTTTATAAAGTTTAGTCCATTAAAAAGC
AAAAAAGAAAAAAATGAAATAAGATGGATTGGATTATTAGAGACCTATATAATTATCAAATTGAAATGAAATAACTGTACTAGCTAGCTAGTTTTAAAAAATAAATTAATGAAGGGTTAG
AGTTAAACTAAAATTCATATATTTAGATATAGTTTCACTTTTGCTTCTCACATTAATTATAGTAATGTTTGTGAAAGGTTTGAGGTGATCATCTTGATTTGGACACCTAATGAAAAATAA
ATTATGATCAAATTGGTTAGTTATTGAAACAAATTAAAGTCCTAATATATCTATATATATATATTAAAACAGTAAACATGAAAAGTAATCCATCATTAAATTTGTTGACTTTTTGGAAAA
GGGGACCCCTCCTCCTGTCAATTATAAACATATATACATATACATACATACATCAATTTCTTGAGTTTGAACAATGGAATTAAGCAATGTGATAAATGTCACAAAATATAACAAAAGAGA
CCCACAAAAAAATTTATACCATATGTTATGAGTTATTTTGGATCAAGAATCACATTGAAGATAAAGCTCTAAATAGGTTAGCTCGATATGGATTATGAAATAGGAAACTGCAATTACAAG
TATGAGAGACAAAATTGACTTTCTTTAACTTAACTAAACAATAAACTTTCAAGGGCCGGCCTTATAACAACTGTTCATCTTCTTCCTAAAAATTGCTTACTCTAACCCTCTCCAATAAAC
TAATTTAAGCAATTGAGTATTGGAGTGGTAGACAAGATGGTGTTCTATTCTTATTTTGTTTTGTTTTGTAGGTGATCTCTTTTTCAAATAACTCATCTATCATTTGGTTGACTAGATTTA
ATTTTTGTATCAACGAAACGATAGAACTTTTGCGTTCGAAGTACGAAGCTTATTTGTATGATAAAGCTTACCTAATATAGAGAAGAATCAAAAAATATAATTACAAAATGAATTGAGCAC
AATGCTATTATTTCATAATATTCTTTATATATAGATGTAGATTTAAAATTTTTACAACGATAAGGCAAAAAGTTTAAAATACATTCTCATATAATACACTAATTACTTTTGACATGGAAC
ACCATGCTATCAAACACTTTGGGGCGGCTTTCTTCCTCCAATAATTCCTCCGTTTTACATTTTTATATAAAATTTAGGAATTGAATCAAATCACACATTTATAATAGATAGATATGTTTG
AAAGCATACAGACATACATTATTAATCAATGTCTTAATCAAAGCATGCAACTATTCAAATTTGTCAAAAATCAGAGTATGTTTCACTTAATTTAGAATTATATTATACATTACATTTATA
CATACGACACACAAAAACTTGACTTCCTATATCTTTCTCTTCAACTTCTATTTGCTAACTACTACACATCATATTATTGTATTATTGCGTATACTATAATTATTTTATTTACACGAGAAT
ATACAACAACTTCAATATATCAATAATAATAAAAATCATATACACGACATTAATAATCAAAACCCCCATTGTTATCAAAAATTTAATATCTCTTCCCAATTTGAAAAGTAAAAGCTCCAA
AATTATTCTCTCTCCTCACTATGTTCATCAGCCTAATCACGTAAACTCTCGCCGGTGACTTAGCCACCACCACCCTGTCATATTCATAACCCAATTATTTTTTTTCTTAGTAACAAAAAA
AAATCTATAAAAGGACCTGCTTTTATCCACACAATCCCTCACCAAAACAAAAGCACACACGATGGCTTCCTTGTTCAGAGTTGCTTTCTTTTTGTTTCTGGGGTTGATGGTTAGAGCTTC
TCAAGCTCAGCTCTGCCCCACGTTTTACGACGAATCATGCCCCGACGTATCCAACATTGTGCGCCGTGTGGTACAACAAGCTTTGGTCTCTGACGAACGTGCTGGTGCCAGACTCATTCG
ACTTCATTTCCACGACTGCTTCGTAAATGTAAATTTTTCGTATTAATTGTGTACTAGTACACTAATTAATTAGCAAAGTTATTACTATATGATAATATGTTTGTTTGAAAATCTTTCAGG
GGTGTGATGGGTCGGTTTTACTAGAGGACCAACCTGGTGTGGTGAGTGAGCTTGCCGCTCCTGGAAATGCCAATATTACAGGGTTTAACATTGTTAATAACATCAAAGCTGCAGTCGAAA
AGGCTTGTCCTGGTGTTGTTTCATGTGCTGACATCTTAGCTATAGCTTCCGTGGAATCAGTTAATTTGGTAATTAACTTAATAATTAAAACTAAACCATGTCGAAGCTGTTACAATAATG
TAGTTGATGACAATTTTTAGTGCAGGCAGGAGGACCGTGTTGGGAGGTACAACTAGGAAGAAGAGACAGTAGAAGGGCAAATTTACAAGGCGCAATAGATGGCCTTCCAAGTCCTTTCGA
AAATGTTACACAACTTAAACGCAAGTTCGATAGAGTAGATCTTGATTCTACTGATCTTGTTGCCTTATCTGGTAAGTATATATACATAATTAAACCCTATCGTTTTAAACCNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNCTCAAAAAAGACACATCGGGTACACTAGTTTATGTAGCCCACGACCACGTGCATGGCTGCTTCTAATTATTCTTCTCTCATGCATCATCTACATAT
ATACTCATTATTGAGTGTATTGTAAAGTATAGTATTTAGATCACAACAATTCAGGACATTTTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNGAATCAGAAATTGAAAGTGACTCATGTTTTTGTATTCAACACATCAGGTCAAGCAAAGGGATTGAAATTATTTTGATTATTCCATTCCATCGTCCTGCGTACTAGCTGT
CAATCTCTAGATTTTTGTATGCATGCGTTTTCTTTTTTATTAATTCACTTTGTTTTATTTGAACTATGTCTTAATCATACTTTTTCTTATCAAAATTATGATGATTTCTTTTTTGTTTAG
GGATTTTTTACTGTCTCAATTATTTGAATAATGTATAAGATCGATTAAGATGTATTCAAAATTTCCTGAATCAAATTACTGTGATATAACTCAAATAATTGACCTCTGCATGCGCGGCCT
CCTGTCTTTGGGATGGGAACCTTAGCTTTGGTTTCACCCAAAAAAATGAGATATTATGAACATTGATACGTTTTTAGTTCCTTTCCCTTGTTGGCCACAGTGTCATGAGAGTACGTGTAC
GTAGGGAGCTAATTTGTACAAAAACAATGGTAAATTGTTTGAACATAGCAAAATCTATATGATAGACTTTAATCAGTGGCAAATTATCCCTTTTGTCTTTTACCAATGATATGATCTATC
TTAACGTAAATGTAAAAATGTGATGTGATAGGTGCACACACATTCGGGAAATCGAGATGTCAATTTTTCGACCGACGTTTAAACGTTTCAAATCCAGATAGCACGCTGAATCCCAGGTAT
GCACAACAGCTCCGTCAAGCTTGCAGTAGCGGCCGAGACACGTTTGTGAATCTGGACCCCACGACTCCCAACAAGTTCGACAAGAACTACTACACAAACCTTCAGTCCAACACCGGCCTT
CTCACCAGTGACCAAGTCCTTCATTCCACTCCCGGCGAAGACACCGTCAAAATCGTCAACCTCTTCGCTGCCAGCCAGAACCAGTTCTTCGAAAGCTTCGGCCAGTCCATGATCAACATG
GGAAATATCCAACCGTTGACTGGTAACCAAGGAGAAATTAGATCCAATTGCCGAAGGCTGAACTAAAATTATATATATGATATCATATATGGTGGTTCCGTTACGGTCAAACTCAATTGT
ATTATAATAATCATATCTTGTTTTTGTGGTTGCTTTTTATTGTTCGAGGGGAAAAAGTGGGTTTTGATCAATTTTCTCTTGTGGCTTAAAATGAGAGAGTGCATGGGGATGCCAAACATC
AAAGCTCAAAAACATATAGTGTCTTTTGTTCTATATATGATCAATAAAAGTGGTGTCTTTCTATTTTACAAAAATGTATAGTGATCAAACCAAAGGCACAAGCTGCTTTTTCAACTGTTA
CTATTGAGGGTGAGTATCGACCGGTCCAAATTGAGTTTTCGACAAAATTATTAAAGTTTTTTCACTTGTTTAAACCGATAGATTAACCAATTAAGTTGTTTTGATCGCGAGGGACAAAAC
GGAAAATGGTCGACAAAGAGAGACATGATGAGGGAGAGAAGTGGCGAGGCGTTCGGGACGTAGGAGAGAGTGACGTTTTGATGAGACAACAAGCGACAATTGACGCTAAAAAATAACAAA
ATAAGTTCGATCAGTTTAGACCAAATTACTTATGTCTCTCAGTTTAGACCAAATAATTTTTTGTCGGCATACGAACAATGTTGATTTTGTATATTTAACAAACATAATTTCCAAACTACT
CAAGTGACTTTGATTAAATTGGTCAACTTGATAATTTTAGTACGTACGTGATGTTCACGGCCTACAATTAACCTCTTCTTAATAACTACTAAATACAAATTTTAACTACTTTTTAACTTC
TCTCTTCCATCCAAAGGTACAAAATTATTTGCTTAGAATAATCTCTTATCATATTTATGGTTGGGTTGAGATTACCTATCGATTAGGGTTATTAGTACATGAAGTAAGTTTAAATTTCTC
TAGGCTACACGTCTTAATTATTCTCTAGTAGTAGGTTTCAATTATTTCAATCTCTAATGTTTGAAGTTTTCATTTTCTCCTTTCATTTATTTCAACAGAAAATTGAAATGGAAAAAAGCA
ACATTATATTTTAATTAAAATACACTGCCATTCATGAGGTGTAGCAATCCAATTTTTGCACACTTCTAATTTTAAAATCATGAGGGGATGATAATTTCAAGCCAGTGCCATGGCTTGCAA
TGTTTAAGTGTTCCTTCATCTTTCTATTTTTAAATTATGAGAAACTATAACCAAGTTTTAGTGTGTTACATGTTTCTTTGCACATGTTCTTTTTTTAACTTCACTATTTATTTTTTTTTG
TTTCTTTTATATCTAACTAATTTTTGTTCTAATCCAATTATCAATCGATAATTTTAAGATGGAAAATCACATGTTTCATCAATACCTAATCCGATCTTAGATCCCATGAGATTCAAACAA
ATATCTAAATTGTTGAACCTACAAAAGTACTATATCTTAAGGGCAGATATATATGAGAATATCACATCTAAAAACATAACGAAACCTCAAAATCTTAATTATAAAGATAAATGATATAAT
AAGATCGTTGGTTGTTTAAGAGATAAATCTACATACTCATTAATGAGTCCCTCTAAATCGTATTGTGATAAAAGTAATTGTTATTAGTGATGTATTTTTTCATTTGTAGGTTTGATGATA
TAATATCAAGTGAACATTATATGTAAATATTTTTTTTTTTTGAAGAAAACCAATGTATTGAAATAAAATTATGAAACTTACATGTATCACACGTGTAATAAGCTAATCAATTTAAAGTAT
CGTCTATAGTTAGATATTCGTAACTCGTAATTCATAATGGTTGAATTAAAATAAATAGAAAGAGTCCAATTTTTAATGTAGAAAATAAAAGAAAAATAGCAATATCTCACTGTCACAAGT
CTTATTGGATAGTGTTGTGAATGAACATTGATTAATGATGAACTTAGAAAATAATAATAACAATAATGTTGGTGTAGAAAATTTAATGCAGGAGTAATTACACAAATCTGCTAACCGTTC
TCTTGACTGCGTCTCTGGTCAATCATGTTAATTTGTTTGGTTTATGGATAAAATAAAATTTAATGATGATGAAGATTCCCAAAGAAAAGAGGGAATGGTAGAGTGTTAGAGTCATTAGTT
AAAATGTCAAATCCCATGCATAAATTAATTTGTTTGACGAATCCCCCGATTTATTGGACCCACACACCTGCTTGATCTTTACCCATTTCTTATTCACCTTTATATCTTGTTCGTTTGCTT
TGGGTGCTTCGATCGGGATCGAGTTTTTCAATATAAGTTTGTGTGATATTTATGCAGAAAGGACTTCGAATGTGATCTCTTAAACGGTGCAGTTGCCTTCGGTGGTGGAATTCTGTCATA
CTTATACAACTACAATTAAGAAACAAATGAAGTGCTAATTATTAACTCCACTTCTATCAGAGCTAGAAGATATTTTATGTGCACAGGAGAACAATACGAAATTATCCGTTCAGTTTGCAT
ACAACATTCTGAAAACATGGTAGGTGGATAGGGTTGACTAAGTAGACAACAAATGAGTCTCATATCTCACTGTTTAGTTGTCTAGTTGAAGGTTGATATGGATAATTGTTGAGTGTGTAT
ACATATATACACTCAACATACCCAGTCTAGTTGAAAATACACCTTTGATCATTTGATATTATTTACATAAATACTTGACTCTTTTTCTTATGGATGAGGACTGAAGGTTGTATGGCTTTT
GGTTATTTTGTTCTCTCTCCAGTACTGCTTTTCACACAACCGCTTCCAGTCTTATTAATTCCCATCTTTGCAGTACATGAAAAGAATATTTGTTACTAATTATTAATCATTTTGTAATTT
GATGCATAAGGGTAGATTTTAATGATTGGGTTAATTTTAATTCCGATATACCAAAAAGTAATAAAACACCTCAAATTTTCTTTCAAGTATGAAAACGATGAACACAGAGAAAACAAAAAG
ACAGATGAATGTGCATTAGAAGAAAAAATGTGTTTGTTCTCTTTATGCAACATGGAGATATATGTGTTGACCTAGGCCTAAACTGCCATGCCCGATCCCCAAACCTCTATTCCAAGGATG
AGGTCGAAACTCACTCTCCTCATTTGATGAATGAGACATATTACTGTACTTATGCATTGTAGTCCCTAGGCATTGTGGAGTACCATACCGATGTTCAAATTTTTCTTGTTTTACAAGTCA
AGTCTTCCTTTCAATTATAAATGATAATGAGATCAACAACTATGTAAAAGAAACTTTTTCATGATTGATCAACTATTTTACCATACAAGATATGACTATGGTAGAATCGAACTTTTAATT
TCAAGGTTGCTAGTAGAACGTGTACAACTAATTAAATTATATGTTTTTTTCTCTTTCTTATTTTGGTCATTTTAAATTATTCAACGTGTAAGTTCATTTTAACAGAAGGTTTCATTTTGA
TTTGGTGCTTTAATCAAAAATTAAGATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAAATGATAACAAAAAAAAAAAA
CTAAAATGTTTCACATTTAAGTGAAAACATTACAAATATTTATAGGTAAATAAAATTACACCAACTATACCACCACCACACGAATAACTTATATTATACCCTAACCTCAAATAATTCTCC
AAAAATCATTAGGCTAAGGGGACTATACCCATATATAAAATAATGGTCACTAGCAATATTAATTATTACTTTTTAGAGAAAAAACTTATCCAATTACTCGTAAATTTACCTACATGAGAA
GCTAAACAAAACATTATTATATCATCCGTACTTGATTCAATATCAAACCTAAAAAATAAAACGTAAACATTCTTATATCAACCTAGACATTAATTGACATTTAACTAATAAATTTTTATC
TACATGCATGTAGCTAAAATTGTTACAAGTACGNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGTGGATATTGTAATTGATTTTAAGAAAGAATATTAAATGCAATTAGAATTCACAAT
CACAAATTTCAAAACTGGTATCAAATTAAATCGGATGGAAGGAGTTAATTTATGTACAAATTTAGGATATTGGGTTAAGTATGTAATGGAGAGGGGAGAAAGCAATAATAGAGAGAAAAA
GGGTCCCATATATCTATCCATTTAGCCCACCAATCACGTGGATTACAATTCTAGAAAAGCCTTTTTGATGTAAACTCAAAAGATACTTCAATTTCTTAGTCCAAATTAGCGGTTTGGAGN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNCAATCACTATTGTTTGAAGTGTTTGTGTCAATCACTGTTGTAAAGAAAAATCAAATGTCTATTTCCCTCAAACCAAGAATGGTAGGGTTTAT
AACTCTTAGGTGACTCTTTGGTTTATATCTTAGAGCCATACAAGAACATGAATATGTCACTTTATAGCCATCTCCTCTGACTAATTACAACAGCTTATTCCTTGAATCAATTTTTATGCA
GTTTACAATTACGTTGTTTAATCCTAATCAACTTTTCTTTTGTGAGTTATATGTTTTTTCTTCAATCACAATTGAAGGGATGCATGAGCTCAACCACAACTAAGCGTTGTTCTAAAAGAA
AAAGAAATAGAAGTTTTTTAGTTTGAACGTCACAAGCAGTTAATTGTTTGATTAAAAAAAATGTCTTGTTGTATTTCTTTTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNCTAACATACCAATAACTTATAATAAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATACTTTTGGGAGAAACACGAGATTATGTATTGG
TGAGAGCATGAGTAAGAGTACCGTCTCTCACTTATCAGAACGGACACGAATAACATATTATCTANNNNNNNNNNNNNNNNNNNNNNTTGATTATTTTATTTCTTTCAACAAAATTCCAAA
TTAGTTTGAGCTGTCATCTTGAAGATTTGACGTGAAATGCAGCCTCATAGACTTTTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAAACTTAGTAAAATTAGAGTGGAATACATTA
CCACACCCCCAATTATTCTCTTTACTAACCATTGGGTTCTTTATATAATTCTCCATCTTAATTAATCAATCATTAATTTTTTGACTTTTTAATTTTTATGATGCCTTCCTTCAAACCCNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGAAAAATCTCCTAAAAATCCGATAATTCTGATGAACAAGTTTTCTAAATTTCAACCCATCAATGAAAAGGAATCAAATTA
TAATTAAGGTCATGTTGGATATATAACTAGCAGCCATGTAAGAACTAATTACCTTTTCTTTTAATAGATATATTATTTTAAGAAAAGAAAAAAGAAACACCAAGCAAATTGCCCTTTAAT
TATAATTAGCTAATTAAAACATGTTGAAAAGTAATGAAATAATTCATTTAATTTGGTGTCTTCTGCTTGGAATTCCATGGCGTAAATCATTTGAATTACCATAATAATGTTTACAATATA
CATAATTCAACTTTTGATAGAGATAGCATTTTTTTTTTAGTTAACTTCGCTAATAATTAATCAAAGATTTAGTCGCTAATTAGCTTTTGATTATAAAGAAGTCAATTCAACAAACCCAAA
GTATGTTTAATAATAGGAGAAATGAGGAAGAAATGATAAACTTTGATTCTCCAAAATTGAATAATTCCTCCCCATGTTATGTGCAGTGTTTGTTTTTATATATATTCCCAATAATAATTA
GATTAAGAAAAGGAGGGAAGAAAATTCAAAGTGGGGAAAATCCATGCAAATCTGAAATTTTCTATTGAGTTGTGTTTTGAAAAGTAAAAGGGTTGGCTTATTTTCAACGTTTGGATTTGT
CTTGTGGTACGTAGCAGAGCTCAGCCTCACCACCCTCTTCATCTCTATAAAAGGACATGCCTCTGTTTATACTTTCCCTCACAACTTAAAGTATTAATTAAAGCTTAATTATTATAACAC
ATAAGTTTGTAATAATGGCGGCTTCTTCTAAAGTTATTGTTTCTTTGGTACTGTGTTTGATGATGGCTGTGTCTGTGAGATCTCAGCTTAGCTCCACCTTCTATGACACTACATGTCCTA
ACGTATCAAGCATTGTGCATGGTGTTATGCAGCAAGCTCTTCAAAGTGACGATAGAGCCGGTGCCAAAATCATCCGTCTCCATTTTCACGATTGTTTCGTCGACGTAAGTTGCTGTCTTA
CTCTCTTTGCTGACTTTTTAATTAAAAGAGTTTGTAAGTTGAAAGGATTATGATGTAATCAAATAATTATTGTTGTATATTTGCAGGGTTGTGATGGGTCGGTGCTACTCGAGGACCAAG
ATGGTATAACGAGTGAGTTGGGTGCACCTGGAAACGGAGGCATCACGGGTTTCAATATTGTTAATGACATCAAAACCGCAGTTGAGAATGTTTGTCCAGGAGTCGTTTCATGTGCTGACA
TTCTAGCCCTTGGTTCTAGAGACGCAGTCACCTTGGTACCTAACTATTCCAACCTAATTACCATTTTAGGTTAATTAACTCATTTAATAACACAAGCTAATTAAGCACATATATATGTGT
TGAATAATTTTGTAGGCATCAGGACAGGGTTGGACGGTTCAATTGGGAAGAAGAGACAGTAGAACAGCAAATTTGCAAGGAGCCAGGGATAGGCTCCCAAGTCCTTTTGAGAGTCTCTCC
AACATCCAAGGTATATTCAGAGATGTTGGTCTTAACGATAATACCGATCTCGTTGCTCTATCAGGTAATCAATATTGATAGCTCGTATGGTATAAAAATATATTATTTGTCATGTGGTAA
TTAAATATGAATTGAACGACAACCAAGATATAACGTTAAATATTTTTCACACATGCATATATATCACCTTTTTATCTCAATTGTTAAACCCTCTCTTTGAGTTTATTTAATTAAAAAGGA
CGTGTTTCATGCATCTTTTAACATGCAGTACACGTATTTGAGTTTGTCATATGTCAAATTATGAATAAATAATCTAGTAAGATACATATACAAAATTAGTTTTACGTACAAATGATTAAA
TATTTTTATGGTATACACTTTGCAGGTGCACACACATTCGGGCGTTCAAGATGCATGTTTTTCAGCGGACGCCTAAACAATAATCCAAACGCAGATGACTCACCCATAGACTCGACATAC
GCGAGTCAGTTGAACCAAACTTGTCAATCAGGGTCAGGCACATTCGTGGATTTGGACCCGACGACGCCAAACACATTCGATAGAAACTACTACACAAACCTTCAGAACAACCAAGGGCTT
TTGAGAAGTGACCAAGTTCTGTTCTCCACTCCAGGAGCTTCAACTATCGCTACTGTCAACAGCTTAGCCAGCAGCGAGAGCGCATTTGCTGACGCCTTCGCTCAATCAATGATCAGGATG
GGAAATCTCGACCCTAAGACTGGAACCACCGGAGAAATCAGAACCAATTGTAGAAGACTCAATTAAGATAATAATCAAACCAACCACGTCTCATCATATATACTTAATTAATGATTCCAT
ATATACACCAAATGAAAGTGTATTGTTGTTATATGTGTGTGTGTGTATGAGTTGGCCACGTCATATTATCATATATTATATGGTCAAACTCAAAGTAAGAATAGAGAGTTGAATAATTGG
GAGAGAGTCCATATCTCATTTAGTTTTTGGAGAAAAGAATACAAATGTGATTTTCTTTTTGTGTTTGTTATAACGTCTAATTATTATCACATCAAACTATATATCTCAATATCTCACATC
AAATAATTACTTTTCTTTTCTCTTTACTTCATCCAAAACCACAACTTCTATCTTTAACAACTAAAACACATAACTTCTAGCACCTAAGAAAAATTTCAGGTTTAAATAATCCTATCTTAA
TCAATTATATTTGGTTCATACATTTATCCTTATAACTAAAAATATTACTTTAAAAAATAGAAAGTTCATAGACAATCAATTTAACAAAAGCATATGATAAAGTTGATGGAATAATAGAAC
TTAAAATGGGAATTCAAACACTGGTTATAAATAAATTAAATATACAAAGTTAAACATTAAAATGTGTGGATATTTAATTAAGTTACTAATTAATCAATTCTATTAGCTTAGCCNNNNNNN
NNNNNNNNNNNNNNNNNGACTAAAAGTTTTGTATACTAATTATTAAATACACATCGTGTAGTTCATTCCGATTGAAGAAATTATTAATGCATAAAAGACTAAACCAAATTAATTAAAACC
CCATGGAATTTTTCGTATTCACATAATTAATTATAAAAACTCATCAACTCTCTTCATTTTTTCTTCGTTGTAATCATTGTGTGACTTAGTCACCATACATACAATAATATTTAAAATTTT
GGCTTCTTTAAACAGAAATACATAAACGTTGAATGAGAAAAACAAAAATAGAATTAATGAATCTTAACCATACGAAGAATATATATATATATATAAAGTCATGTTATGTGAAAGCAGAAG
AAATTAATAAAATGATAAAATGATCTTAATTTATGTAAACACGAAGAAATCATAACAAAGAATTGACCATATATTATATGTTATATATATGTAAATAGGATAATTTGAAAACTAAGTAGC
ATTCCCACATAATTAATTAATGTGGTACACTTAATTAATTAGAGTCAAAATGGTGATGAAGAGTCATAATCTCAAATAAATATTGATGAATAAGTTGAAATTTTAATTACATAAACTACC
CATGCCTCTAATTAACCAAAATATGATAGAGGAATATAATACGAAGGTATAAACAAAGTTGGAAATGACTATACGATCTTTCTCATCTTCGCCACATGACATAAACCATATGATATCTTT
CGAATCATCAACGATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATCGAAAAAGTTTATTATATATTTGTATGTTGCGATACCGTAAGTTTTACTTCAA
ATTAAGAATAATGATATGTGATAGATAAATGGATGATGATCTTCACACACTTCAAAGAATAAGATTCTTAACTTTCTTTTAAATGCCAAGAAAAAGTTTTTGTTTCTTTTTCATTTCATA
GAGAATAAAATACTTTTTTATGGCATCAAAATTAAAGTAAAAACGATAGGGTGGTTTAGGCATCGATTTTTAATTTATTTCACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTTTTTAATATAAGTGATAGAGAGAATGAAACATAATTAGTACAAATTATAACAAATAGTATAATTTGGAAAAGAAATTCTTTAAAATA
TAACACAACTTCAAAAATCTTTATAAATATAGTAAATATTGACCGTTCTAACTTATAGTTTTTCTATATATATAATTTCAAGTTTGTTTTTCAATACATTCGTTTAATTTCNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
GTAGAAAAGAACCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNGATGGTTATACTATTTATGCTATTATTTTAGACTTTTAAAAGGAAGGTTTATGTTGGATGCATGTGTTTATATATACTTAATTTATTTTGAAAGTAGCAACAAAAAGAGAGAACA
AAACTAAAAGTGTAAAAGTAGAAATGAATAAATAAACAAATAAAGGAAAGGCATATTGTGGTGATGAATTGGTGAACCTAAGAACATGGGGGTGTGGTCCTTTTTCATAGCCAAAGTTTT
GATGAGTTATGTCTCTTAAAATGGTCAGCTCCAATAATAACATCAACTAAGAACGTTTTCATTTTGGTAAAATGTTCTATAAGAGACTTATAGATGTAGCCTTTTAATGGATTTACAGAT
AGATTGATGAAGTATGAAGAAGAAAAAAGACAACAAGTTTTTGAACAGTGAAAGTTAAATTTGAAAAAGAGAGATAAAGTAGAGAGAGAGAGAGAGTTAATGCTATGAAATTTTGGAGAC
GTTGCGTGCGGGCAATGTCAGCTTCTTAGCCTCGGCCTTTGCAAAACCCAATACTGTCTTCTGTTCCCTTTTCCTAATAACGACGAGGTGCAGCGCAGCATTCCCTCATTTTGAAATGGA
TTTTTCATTTTCCATTTCAAAATGCTTTAACCCATTTCTTTAATTCAGCTCAACCAACAACAATCACACTCACCGGTCGATCCATTTTGAATGGGCTGCCAAGCTAAGCTCTACCATTTC
TTTGACTCTTAACCCTTTTGTTGTTCCAATCTAAACCCGACACACGCCCATTCCTTCTTCTTTCTCTTTCCATTTCCTTTTGGGGCCAACCATTTCTGCAATTATTGGGTTGTTCAGCGG
CGTTAACCTCATTTTTTCGCCATCTCCACCTTCCCCTGCTGTTTTCTGGTCGATCACTCTCGTACCCTTCAATTTTTTCCATCTGGGTATGTTGATTTCTTTGCTTACTGATGCTTTATG
TTACTCTACTGTTGATTATTCAATTGGGTGTTCAAATTTTCTCTTGGCTTTTGTTTGATTTCGTAGTTCTTGTATATTTTCTTTCTATACATTGTTTATCACTGTGCTGCATTCTGGTTA
TGTTTATGCCTGTTCGATGATTTTGAAACGATGGTGAATTTGTCTGTTGTTTTTCTTTTTGATTCTTAACTGAAGTGGTTTGGATGAGAAAAATGCTGGCTTCTAGTTTTAAACAGAGAT
GATTTAATACTCGTTCTATTAATAGATTATAGGTTGTTTTCTTTTGGTTTTCTTGTATTTTACTTTTCTGTTTATAGATTCTTATCGCAGCACAGATGCCAAACTCAGTAAAGAGGAAAA
GAGAAAGGAAAAAAAATTGGTGCTTCTGTTGGGTTTTGTTTTCTTGCTGCTTGTACTTGTGCCAATTAATGATATAGCTTTTATTTTCTCACTCTTAAACGCACTTTTTCTGTTGTGCAA
GCAAACAATGATTCCATCCGATTGTAACTGTCATGTGTTGTTGTAAATTTTAATGCATACATGAGTTTTCAATTTAAAGAACGTTAAAGATTCTTCCTCGTAGCTTCCGTTTCCAACAGG
TTCTGTTCTGTCTATGGTATGTTATTATAAAAGAAGGATTTAATGATCCAAAACTTAATTGATTTTACTTCTTGCGCATGCAATGCTTTCAAATTGCATCTTGCTTCTCATTGCTCTTGA
TTACTGGATGTGAAATTCATTTTGGTATGTAATAAATGCACACAGTTATTGTCCTTGATTTGTGATTTAGGAGATCCATGTTTTGAATGTTTTTTCTATTATTATCCTATTTGCATTGTA
CATTTGAAAATAAATATCATTGAGTGTGATGTTTAAATGGAATCCACATAGCTGAAATGATCATCCTACTAAATTGATTGGTCCAGGGAACAAGTTTCGAGATGCTTGCTTATCATAAGT
TTCTACGGAACCAATTATGAGTTCTTCAAACAAGTCCCTCTAGCAATGACACTTCTTCTTTTTTAATTAAATTTCAGAGATGATTGTATGAGTACCATAATAGAATTCAGAGAGAAGGGG
ATGTATCAGCAACCCAAGTCAAGGGAAGAACATGCTTCTTCTGCAGCCAGCTTCTGCAAAGAAGTGACCGAGTTGCGCCTTACATCGATAGATTCTCAACCAGCAACTTCTCGTCCTGAG
TTCAAAGGTGTCACTTTCAGGAAAGCTTCAACTGGTGGCTTTGCTAGGAGTCGTAATGATGTACACGAGCTACTTGATTGTACTGTTTGCATGAATTTAATGCATCCTCCAATTTACCAG
GTATCGTATTCTTATTGTGATGACTTTCAAAACATATAACGCTTTGCTCATTGATTATTCTGAAAAAAAAACGTTTCATAGATAAATAAATTCATCCAATAAATAGAACACAGACGCATT
TAATTTGGTTGAAGGCCTAGAACCCTAATGGATAATTGAGTCATTCTTTTGTCCCCAGAAATAGCTTTCGGACCAAGTATCAAAAGGACTCTATATAACTTCACTTTCTGTTCAAATGGA
AGGCTAGGAATTTTGTTTAAGCGTTGATTTGCATTATGATTGAGTTATTACATTTGAGGTAACTCCAATGCATAACAGCTAACGTAATTTTACGGTTCAGTGTGCAAATGGCCACACTCT
TTGTTCAAGCTGCAAGGCAAGGGTTCAGAATTGCTGCCCTACCTGTCGGCATGAGCTTGGGAACATAAGGTGCCTAGCACTGGAAAAGGTGGCCGAGTCCCTTGAGCTCCCTTGTGTGTA
CCAAAACCTAGGTTGCATTGACATGTTCCCATACTACAGCAAGCTTAAACACGAGAAGAATTGTAAATACCGGCCGTACAACTGCCCTTACGCTGGAGGTGAATGTCATGTAACTGGTGA
CATTCCATCCCTTGTCATGCATCTCAAGGATGATCACGAGGTGGATATGCATGATGGATGTTCCTTCAGTCATAGATATGTCAAATCCAATCCCCAAGAAGTTGAAAATGCCACATGGAT
GCTAACTGTAAGATGTCTCTCTTTATTTCAGATTCTTAGGAATAATGAAAGCAAAGAAGAAGCAATTTCATGTAATGAACATCCTCCTGATTTCTCAATTGATCCAATTCAGGTTTTCAA
CTGCTTTGGACGACAATTCTGTTTGCACTTTGAAGCATTTCGCCTAGGAACAGCACCTGTTTACATGGCATTCCTCCGGTTCATGGGTGACGACAGCGAGGCAAAACAGTTCTCATACAG
TCTTGAAGTTGGTGGAAATGGAAGAAAACTCATCTGGCAAGGTATTCCAAGAAGTATTCGCGACAGCCATCGGAAGGTTCGAGACAGTCATGATGGACTAATTATTCAGAGGAAATTGGC
ATTATTTTGCTCTGGAAACGAGGGGATGGAACTGAAGTTAAAGGTTACAGGACGAATATGGAGAGTGAGGTGACAACAACAAATGAATATTCATCTATCAAACTCAAAACTTGTACAATA
TGTTGTGACATTGTGACCTTTGTACATGCCTCGGCCCTCCTACAATTCAGCCTTTTTTTAGAACCTCTTATTTCTTCATCACCTCTACATTTTCTGCTTCATTTTCTTTTCTCTATAGNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNGAATGATAGAAATAAAACTAACAAGAATGCCAACCCATTTTCATAGTAATGCAATGCTAAATGTAAAACAACTCAGCATATTATGCATAGAA
CTTAGAAGAATACAAAAAGGTGTTGGACAACTTTAACAGTTAAGGCTATTGAAGTTTTTACCTTTTTGGTTCTTCACCTTCTCTTCTTTTTATGTTGTTGAAAGATAACATTTGTTAGAT
AGTTTTAACAATTTATGTATCATAAATTTTGAAAGTTGATTAAACTTTGTAAATAATCTTAAATTAAATTGTGATAAATTTTAGTTAAATTTAGGGTTATTAGGTTAAGNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGAGAATTGTAAATATGATGAGAATTGTAAATATGATGAATCTTATTTTAACACACCTTAGCAATATGGTC
TATCACTCATCATATTTTAACACACACCTTAGCAATATGGTCTATCACGACTATGAACACTTTGAAATGGATTATCGCGGTTGCGTTAAATTTGAAAAATAACCCATTTTCAAAATAGCT
TTTAAGGTATGTAAGGGTTTAAATATATGGTACTTGGAGAAGTTACGGCGTCGTTTCAACAGTATCTAATAGCTTCTCATCAGCATAAACCCTAAACCCTGTGAAGTGAAGAAGAGAAGA
AAAATGTTGATTGCTCGAAAGCTTTCTGCTTCAAACCTCAAATCCTTTCTTTCTTTGCGTTTCATTTCACACTTGTCTTCTTCACCTATCTGCTCAAACCCATCAATCCTTTTCCCACTT
CCTTCCACTCTTTCCCGTTCTTTCTCTTCCGAACCCACTTCTCCACAAGCTTTGAGTCTCTCCCGTGATGGCAACTTTGACGAAACCACTTCCCGATTCTCCCTCGTCTGCCCTGGTTGT
GGAGTTCATATGCAAGACTCCAATCCCAAGCATCCTGGCTTCTTCATCAAACCCTCTAAGAAAGATTCCAATTATCGTCTCCTTACCCATCTCATTCCCGTCGATGATGAATCCGAATGC
TCTGAATTTCTCAAGAGAGGCCTCGTAATCGAGCCTGAAAAGGAGAAGACTGAAGAGGATGTGAACGAGAAACCCCAGAAGCCGACCGTGTGTTCGCGATGCCACTCGTTGAGGCATTAT
GGGAAGGTAAAGGATCCTTCAGTGGAGAATTTACTGCCTGATTTTGATTTCAATCATACTCTCGGTGGGAGATTGGTGTCTACTACGGGAACCCGATCTGTTGTTCTAATCGTCGTTGAT
GCTGCAGATTTTGATGGGTCATTCCCAAAAAAGGTAGCGAACTTGGTATCGGCGAGTATTGAGAATAATTCAGCCGCCTGGAAACAGGGGAAATCAGGGAATGTGCCGAGAGTGGTGCTT
GTGGTGACGAAAACAGATTTGCTGCCTAGTTCTTTATCACCAGAAAAATTCGAGCACTGGGTGAGGCAGAGAGCGAGAGAGGGAGGAATCAACAAGATAACGAGTTTGCATATGGTGAGT
TCAATTAGAGATTGGGGGATAAAAAATTTGGTGGAGGATGTAATTGAGTTGGCTGGGGCAAGAGGAAATGTGTGGGCAATTGGAGCACAAAATGCTGGGAAAAGCACGTTGATTAATTCA
ATAGGAAAGCATGTTGGTGGGAAGATCACGCAGTTGACTGAAGCACCAGTTCCTGGGACAACGTTGGGGATAATCAGAGTAGAGGGAATTTTTCCTGCTCAAGCCAAATTGTTTGATACT
CCTGGCCTTCTGAATCCTCATCAGATTACTACAAGATTGACAAGGGAAGAGCAGAAACTTGTTCACATCAGCAAGGAATTGAAACCCAGGACTTACAGGATTAAGGTAATGAAGTTGATC
TTTTTTATGATCCTTTCTCATGCCTGAAATTTGATTCTGCTTCATTACCATTGAACCCTCGTTCTTTAAGTTTTAGTTTCAGAGAAGGTTGGGTCTTGGGATGGATAGGCCGTAGGCTAT
AATTTTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNATTGACTAAATTAAAAAAATATGGTTTAGGAACCATATCGAAAATCTAAGTGAATATCAAGTTTTGTTATGCTGTGAAATTGCGATTGGCTAAATAGC
AAAATGGTATAATACTATATAATGATTTTGAAATTGTGAGCGTTAAGCTTCTACTTCCAATTTGATCCTCTATAGACAAATATTTTCAGCAAGAAATGTGGTTAGGAATTCATAACTTTG
GTGTTGCATTTTATAGGTTGGTCATACAATTCATGTTGCTGGTCTCATGAGGCTAGATGTGGAAGAAACAAATTTGGATACAATTTATGTTACAGTGTGGGCATCTCCTTATCTTCCATT
ACACATGGGGAAAACAGAAAATGCAACCAAAATGCAAGAGGACCATTTTGGTATTCAATTGCAGGTATTGTTTGCACTAATTAATTTGATGATGAACATACAGGATGGTGATTTTGTGGA
TATTCATTGTTTCTTGCTTTGCTTCAGCCACCAATAGGCAAAGATCGAGTAGAAGAACTTGGAAAATGGGTGAGAAGGGAGTTTCGTGTTTGTGGAACTAGTTGGGATTCAAGTTGTGTA
GATGCTGCTGTTGCTGGCCTGGGTTGGTTCGCCATTGGCCTAAAAGGCGAAGTAGTCTTAAGCATATGGACTTACGAGGGGGTCGATATTGTTTTACGAAGTTCTGTCATTCCTCATCGA
GCAAACTTCTTTGAAGATGCTGGATTTACAGTCTCGAAAATTGTCTCCAAGGCTGATCAGGCTTCCAATAAACCACTTGGTCAAAGTGAAAAGAAGAAAAAGAGTGACCCCGAGGTTCAT
GTGCTTGCTCAAACGTAAGCATTGAGAGCTCACTTCGACTATGATTTTGCTTAAATGTTGTAGCATTGAACAGTAAGTGATCTATATCAATGTACAAGAATGGGGTTTGTCGGAATTTAT
GCTGGAGAATAGCAATGCAAGCAACTTCAAGCCTTTCAGCCCATGATAAGTGTCCGGGATTTGTGATATATGAAGCCACATTCACGCTCGAAACTCGAACTAGGTTGGCATCATATCAGA
GAGTTGTATACTTAAATCTACTGCTTCATTTTCGAGGAAGGCTTTAGCTTCTATATTCACTACGGGAGGCAGTGCAAAATGGAAGTAATTATAAACTTGAGGAATTGATTGTTTCCTCTA
CGGCTTTGCAGCCCCAAAATGTCGAGAGTTGTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAATCAGGTTGCCCATGTCTGATTAACATCCATCAAGATTAGTTCTTAGTCTTTCGAT
TTTTTCTATTCATTTGCAATAACCAGACTTTCATATTTATAATATAGGTTGAAATTGATCTGATTATGCTTTCTCTTTGGTATAAACAATATGCATTTGACGACTAGAGGCTGTAAACAA
GATTGCCGTCTAACTCCATAGCTATGTTTTTCCACTCACTGAACTCCGTCATGAAGCAACCATGACAAAAGCCGCAATTAGGTAACTTCTACCAACTAGAAACAAGTTATACATCTATTA
CCATCTATGGGCATGGAGCCAATTTTGCAAGGAGAGATGAAGTTCAGGAATTTGGTAATAAGCGACCGTTGTACATCTTATCAAGCAATTGTCGTGCGTCGGGCCTTCTTAGGAGACCTT
TGTTGTTTGGTAAACCAGTCCCTAGACAAACAGGGCATACAAGTTTTCCTCTACCTGTCACAATAAATTTTGAAAGTTAGTAGAGGGTAAGAGATGAGCACAGATATTGGAAGTTTAAAT
GTGATACATTTCAAATCCATATGAATCAAGAATTTTCTCTAGTTGCCAGTTGTAGTTGGTCAATACAGAAATTGTCGGTCGGTAACAAAGACAAGTGATGAATGCAACAAAGAAACCAAG
ATTCTTGCTTCAGATTTCACAGTGGGTTTAACAGCATATTGACACCCAAGGAATGTTTTAGTTTTAATATCTAACCACGACTTGATCATATGAGAGAACATGGTGAATCAAAATATTGAC
CATTCGCCATGGTCTATATTTCTGGACATTAANNNNNNNNNNNNNNNNNNNNNAATCGATTTTCTATGTCTCAAGGCTACAGCATTACAAGAGGACAGGACAATGCTTTTAAACAGACGT
GAAGTTGTATCAAACTGAAACCATGCAGATTTATGAAACATTCATTAACGAGGTCACCATAATTTGTAAGCAAGATGAATAGTTACCATAACAATTTGGACATTCTGTAAACTCGTAGAC
ATCTTTAGCCCGTTTTCTATTTAGAGCTTTCCATTTCCCTGTACCACCGCACATGTCACCTAAAACAAAGAAAAGTAAGCATCCCATGGAAAATAGGGAGCATAGATAGATAAAAAAAAA
TGTATGTCTCATCAAACTTCTATACATCTTTAGAGAGGAAAAACTCAAAGCGAGGAAGATAAGAAAAGAAAAGGAAAGAAGTATTTTAACTCCAAAGATAAGCTCATATGAGGAAGTATT
TGATGATTTTTTTGTCCGAATACATGAACAATGAAAAGGATGCCAAAATGATGTAAGTTTTTTTTTACAACGTGTTTGAAAGAGAACTTGAAGAACTTTTTTTACAAAAGAATACACAAA
TAACTTTATCTTTACCAAAATATTTCTTTTCAAGTTCGGTATATATGCTTTATTTCCTTGACTTCTAAATTTTATAAGTCCATGGAGAAGCTCATTACTTTTAAATCACAGGCCTTTCAT
GAAAGAAGAATAAAAATTATATCTAACGACCAAAAGCTGTTATTTCTAACAAATAATAAAAAAGAAGAAGACATGCTTACAAAGTACAGCACCACTTCCTCCACAATTTCGGCACGCAGG
TTTTCCATCCATGGTATTTGCAATAGCTTCAGTCACCGTGCCCCCATAACTCTTCATCAACGTCACAGATGAACATAAACATGTGAGGCACCATCGACGAGAAATCAACTTTTGAGTTCC
CTGTGGTCACAAAGGTTGTTATATATAACTAATTGGACGACAAAAGTGCAGTAACCTACTTAAGATTACATATTAAAAAAGCTACACGTTCCCGTCTCAATGCTGTCACAGAGAGATGAT
CAGATTTATATTCTTAAAACATCAAATCACAGAGACTTGAAAATGCATTTAAGGTAACATTGTCTAAAAGATGGTTAATTGATTGCTTTGAAAAACTAATGAGAAAGTCTACAAGGCTTT
AGAACCTTGTCAGATTCCAATGGAATTTTACATTTTTCGACCACCCACATTTAAAAATTTGGAAGGCTACGCAAGCCATGTCAAAAGACGCACATCATGTGAGGAACTACACATATATAA
GCTCAACATGTTGCTTCCCCATTTGGAGCGCTGTGTTTGTTAATTACTTAAGCGTGTATTGATATCATGAATAAGCTGCCACTACGAAGAAATAAAGCTAACAAGACAAAAAAGTAACCT
AGATCCTTACCTTCAGCGGTTTTGATGGTGTTTTTGAATCCCCAGTACTGCAGCTTTCATCATCAGAATTCGATGTCACATGAAGCACAACAGGCTTTAAGTTAGCTGCTGAATTCAGAA
AAATGAGTATCAAAGCTCTTCCATGGAATGATCGATATATTTAAGATAGTCCAATACAAATCAATGTCAGATTAGTACAAGAACCAGAAAATATCGTTATGATTCTGCACTACTACCAAA
GCATTTCATCATGTAATGCTATCTTGACTTAACCTTCTAATTTACTGCAAAATCGCACCAATCTAGGCATTAGATTGACATACACATGAAAACGTTAACAAGTCCAGCATCTCATATAAG
GCAATAGAACTTATGGGATGAGGTCCTGACGATGGGGTTCCATTCTGTTTAAAGGAAAGCGTTGGCAACTTCAATTTAGAATGACCTTCCATAACTATTGGAAGGAGATCTGATGAACTA
CTTAAACAAAATACCCCTTTGGAACTGAGAAAAAAGATTACTTGTAGTAAATTTGTAATTCTAACACTTGTTAACCAGCTGAGTAAGATAGTATTATCACAGAGCATAAAGGGAAAATGA
ATATAAGCAAATCAGGCAGCACAAAACATGTGACAGAGCAAGATTAAGATAACCCGAAATAACAATAGGAGATGAGGATGACAAACACCAAAAACGAAACTCGAGAAGAAAGGGATAAGA
TTACACAAGCAGTCCACAAAAAAGAAATGACCGAAGGAAAATCAGCTTTTCAACCAAAAAAAAAATCACATTCTTCCACCGATAAGTAAGAAACAAAACAACTGAATGGGCAAAACGGAA
AAGAAATACAAAAATATAAATTGAACAGAGGAGATGGGGGATAGAAGTATGCAACAATGCAAGGATACAGTATAGTCGACAATTGGGCATAAATTCCAAGAAAGTTGCNNNNNNNNNNNN
NNNNNNNNNNCTCACAGTGGGATAAGGAAGGTGGAGAGGAGGAAGAGGGACGGCGGAGGGGAATGGCGGATAGATGAGAAGAAGAAGCCATGATCTTCTCTGTGGTTTGCGCCACTCGTT
CACCTTAATTTCCACCATATACCAAAATCCATCTTCACACTTAATTTTGGATGTTCTCCTTCTATTAACTACCACGCAAATAAACTCCTTATTATTACAACTGACAAAATCGTCNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACATTCTTTAAA
TTTCTCTCACCCACCCAAGCTCACTCCTAAAACAATTGCATCAAATGCACTATTAATAGGCAACTTGACAAATATGATGTACTGTTAATAGGCAACTTTACAAATATGATGTACTGTTAA
TAGGCAACTTTACAAATATGATGTGTATGAAAACCTTGTTTGTTTAACATATGACATGAATGTAGGATAATGAGTTTCAACTATAGTCACTAAGCACACNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNCCAATTATAAACTAATCACATCGTATATCAATATCGCCGCTAAAATATAGAAAAGAAGAAATACATTTGATGTCCATAACTAAAATACAGTGGTAGTTGTAAT
TGAGCATAAAAAGTGAACCCTTCAAGTTATCCAGGTAATAAAATAAAGCCCTTAAACAGTAGAAATTATAACAATGGTATAACCAAAAGAATTCAAATTTCATAGTTAGGATCCAATTTG
AGAGTGCCAAAAGATTGAAGGGTCGAATTCAAATAATTGGATTTTTGAAAATAGGATGCAGAAAGTCAAGGGGTTATGATAAAAGAAAAAACTGAAATTCATGTAATCAGCGGCACCATG
GAATGGAATTCAGAAATTCAATCAGTATCACCAAATAATTGAAGAATGTAAGACCCCAAATAAGAAAAAAAAAGAAAAAGAAAAGTGCATGAATGTTGATGCCCATTATACATTATCAAA
AGCCTGGGGGAGAAATTTGTTAATTTTAAGACTACATTAATATTTGAAACGAAGAAAATCCATCTATACAGCTTTGATGATGGAACCAATTTAATATACAAACAGGGGGCGGGCCATGTA
CTCTCCCATTTACTAAAAATACAGCAATGTAACAACACTATCTATTAGGTAATGAGACTTGGAGGGGCACCAAACAACAAAATCTGCTGCTCTCTCTCGGAATTCGTCGAGGATAATAAT
AATATGTGATTTAAGCTACAGTTCTTCCATAACACAGGCAAGCAAGATACAGATTCTTCGCCCATTTTTCCTGCTCCAAACAAAAACATTCAATATCTTAGTGACATCATTTTTTCTTTT
CTTTTTTTTCCCTCTGAAAATTTGCATATATATCACTCATTGTTGTTCACCCACAGTTTGATTTGGATGTTAAAATCGCTGTACCTTTACATGGGTGCTTGGAAACTGAGATGTACGAAG
TGTTTCTTGAGTCTCGTCCCCAGGTTTGCGCCTAGGGACACTCAAGATAAGAGCTGCTTGATCCCAAGTTGCAGCTGTAGATGTTATTCTATAGCCATTATCCCATCGTCTGTGGATGCC
TTCACTTGGATAGAGAAAATCAAGCTCCACAACCTGTGCAATGAAATAAATTAACAATGAAGAGGTTCAACATACTTTCCACACCAAGTTTAATTTAATGTTTCACAATAAACAGAAGTA
GAGCAGCAACACAATCCCGAGATCACCATATCACAAATTAAGCACAAGAGATATCTTCTAGGGTTCTAAAACAATTGACTTACCCTATGCCAAGTGACGTTCAACCCAAAATACCATGAG
AAATTTTTTTTGACAAGACAAAAAATGCCATGAGAAATAACAAATGAACTTCTTAAGATTTAAGACCATAAACACAAAGGGAACTATACCAATGCCAAGACCACAAAATACAGAAGTGAG
AAATCAGAGCCCTAAAATAGGTGTCCAAGCCCAAACAGAGATGTAAAAAAACATCAAATACAAAGTTGGAATAGAGAATAAGACTGGAGGTATAAATAGCAACCAAAAACAAATTTCACA
AGAATATAATATTAACATACTGAATTGACTGCAGATGCTAAAAACATAAACAAAACTCAACCTGATCACTAAAACCAGCATTGCGTGACATGACAACACCCCATCGGCTTCCTGCAGTTG
CCATTGAGGTCACATGAAACCCTTCTCTCCATTTCTTGTTTATCCACTTGAAGGGGAAAGAATCACTCACTTTGTATGATTGTTGGGTATATTGTGTCCCTGAGGAAGCAGGATAAACAG
AAAGTGAAAATGATAGTAAGCACAAATACATGGATAGCAAGAACCTGCAGAATAAACATCAGAATGATAGCATCTTGAAATCAAATCCAACAGACTTAAATGTACATTGAGATTTTGCAC
AAAATAAAATGCCCACGCCTTATAGGTTATTCTCTTGATCTCATTTACCTATTGTTTTGTTGAGACCAATAGACATAGAGGCAGGAAATATAAGAATAAAACAATTTCTTAATTGTGCAA
GAAAACCAAGATAACAAGGTCTCTATGATTGATCACAGTACGAAGTACAGGAGACAGGAAAGAGCAATTATCCATCACCAAAGTAACAACCGATCTCATATTTACAAAATTGAAGCAGAC
AAACCTTTTGACATCACCACAAGAGAGCTTCCGTTATTAGCACCAGCAATAGAACTGATGTAATAGTTCTTTTCCCACTGTTCCATTATCCATTCCTGCTTATTTCATATCAAATTTAAC
AAACACTTCAGAGAATACTACAAGGATTAAAAACTTCAGTAATTGAAAGTTTACTTCTTCAAAGAATGAAAATGACCTTGTGCAAGAAATACGGCGAGAGCTCATAGACTTGGTTTGTAA
AACCTGTTCCAGCATCCATGATTAATGCCCAAAGATTTGAGCAAGATGCCACAGAACTAATAAGCAATCCATCTGCAATTCCTCTCTCTACATGTTGTGACAACCTGGCATCAGCCACGT
TATAATGATACCTATCACCATAGAAAGCAAGTTAGTAGAGGACATGCCATTAGAAATTTTCCATGGAATGAACACCTCAGCTCAACGTGCCCTTCCACCAATCATTCAAAATACTTGGAA
GAATAGTTCTACAGTTCTTAATTCATTAGACTCTAAAAAAACGTAATAAGATGCATCACAGTTCACAGAATATGGCCCTCTAAAATCAGGTAAATGCTCTTGGTTGTGACGAAATTGTCG
CAGTCTCTCTATCATTTTGAGACTTGATGCAAAAGGCAATTCTTCTAGTTGCATTTAAATGAGAGGAGGGCAGTGAAAGCTGCACCATGTAACCTCACCTTTGCTTCATTGGCAATCGAG
CATTGTAAACTGAAATCCACTGTGTAGCTGGAACACCTAAACGAACTTTCTTCCTTGGCTGCCCATCGTCATCTTCTCCAATGTTCAGCCTGCCACGCTTTTGTCCAACTTGACTAATAA
TCTAGCAATCATAATGAAGAGAAAATTTAATAAAATATTTGACGAAAAATCTCATCCAAAAACCTTGGGCAATTTTATTACCTTCTGTGCACCATCAGTTTTAATGGGTCGAACAGCTGG
ATTTGGTCCAATAAAACCCTCAAATAAAGAAATAAGCTTAGAATAATTGGGTTCTTCGTCAAATTTCATGTTCACCACAATTTCAAGAAATTCTCTAATAGGTGGAGGGCAGAAGCAGCA
CAACATTTCAGGAGATGTTGCCATCTTTTTCTTGCAAACCAAAAAGGATTTGTTGTCACCCTAGCATAAAGGGGGAGGAGGTTATTGACACGGAAACTAAAAGTGTCGACACAGTGTTAA
GTATACTTTAAACTTCTCATACCTGATAGCCTTGCCATGGTAGCCGTCCTCGATGGAGGAATATAAGAGTGTATGCAAGAGATTCCAGATCATCCCTTCGACTAGCAGTTCTGCCCAAAT
GAGCATGAACACTAGCATATCGGACAGTTCCTCTGGAATTGCAGGAAAGAAATGGTATCAAGAACATTGAATCAAAAACAACATAATAAGCCATTACCACATGAGAGAAAAACGCTGCTG
GTGTCAAATCAAAATATCAAATGGACACAACACATGACAAGGATTATTATGGATTCTATAAATAAATAGCACATGTAGTTGATGAAGCACACATCACTCACCTGAACATATCAGGACGTT
GATCATATTCAACATGCTGTCCGGTAGAGCTGTCCTTCCATTTTGTTGCTGTAGAAAAATTTGCAGATATCATTGATAGAAGAACATAACGTAATAACANNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACTTTTTTTGGTAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTTTCTACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCATTTCGNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGTATTAAAAGATAGGTGTATTACTTGCACGATGCATTTAAATA
AGCACAAAAAAATACATATATCGGCCATAGAACTTCGCTCACCTAAACCAAGATCAACAAGAAACAATTTTTTTTCTTGTGCTGTAGAAGGTTGACCGAGTAAAAAATTTTCTGGCTTTA
CATCTCCATGCACATAACTATTTATAATTGTTTCAAAAAGAAGAAGGTTAAGATTCAAAAGATTGAACTACATAATTTATAAACCATTTAAAGAAAAGAATCCGCAAGTACATACCCTTT
TGCATGCATCTTATCCAATATTGATAATGATTCCACTGCAATGCAAGATACCATTTCTGCAGACATGCTGACATAATCCATCCACAATAAGACACATGCAAACAAATGTCCAAAATTACA
TATTCCACAAGGTACAATCCATAAACCAACGCATGATTATTTTCTTCCAGACTAAAAGATTAGAGATACCAATACTGAATCATATGGATTTAGTAATAAGATCAAATTAGTAAGAATTGG
GTTGAGTAATATCTCTAAAGCATAATAACAAATGCATCCTGCAACTAAATCAAGTTTCAAGATCTCATCAAATCTCATTAAAGTTCTAATTTGATAAATTCCCTGGACCAGCGTAAGATT
CCAGATGAAAAGCCAACCCATTCCTAGAGCCAGAAATTGCATTAATCCAATTCACCACTTTACTTTCAGTATCAAAGATAAATAATGACAAAGCATTAAACGATGCAAGAACATGTGAGA
ACTGAGAAGTAAAACAAAGCAGATATACAAGCTCAAGAAACTCACGCCTGCCCTGAAGAATTCCATACATCCCACAAGCTGGGTCCTAGCATGTCCATAACCTAAAAAAAGGAGTTAAAC
ATTTAAACTTAAAGAAACAAGTTAGAAAAATGAAAACTATATACTAAAGAGAGAGATGAAGTTGTTGACACACCATCACATAATAGTCTCCTTGTCGACCCTTATAGTGCACTTTTGGCA
CTCCATGACTACCTCCAAGAGCACTATACAAAAAAGTTCAGAGGTAAGTCAAAACACNNNNNNNNNNNNNNNNNNNNNNNNNNCATCTATGTAACCCAAAAAGTTACTCACTTGTAAACT
TGCCATTCGTATGGAGGACCATAATTGCAACCTTTACTATTTCTGTGCTCAAATTTAAGAGCAACCTGAAAATAAAATAAAGAAATGAAAGGTAAATCTATGAAGATGCTGACAAATTAT
AATTTAGTACATACTGCACCAATTTAGTACAAACAACTTCCAAGATACCTCACCTCAGTAGCTGCAGCACCTGTTGCACGATCGTTTCCACCTGTGAGCCGACGACCAACAAATACTTGC
CCAAATCCACCTTTACCTAGTTTTCTCTCTATTTTATACATTGGTGACCCTCCTACTTGAACCTTGAAACATGCCACAAAGAAATAAATAAACTTACAATGAAACAGAAAATTTGAACAC
AGTCCTTCACTCAATAACTTAAGATTTAAGATGTCCAGCAAAGTAAATGAGCCAAAAATAGATATACGACTTTCTTATTTTAACTCTATACATGAGAAAACACAGTAATCATTTAGAAAT
AAGCACATTAGAAATTAAACAAACAACTATTGAACTAAGAGCCTAAAATTACTGAGGAAATATTCTTGTCAAAATAAACCATGATAGGTTAGGCCAGAAACTTAATGGAATGCAGATGAC
TCAGAAGTTAAACTTTACTGTCAACTAAACTGTTAAATATGGACATTTCGAACTTAAACATCGTTTGGCAAGAGATTGCCCCATAATATTACAAGTGAGCTGGCCACGCATCCACGATCA
CTGTAAGAAAACTTATGAAAAACCACCATCACCCGAAATTAAATGCAAGAAAGACGCTTATTTTCAAGATTGACAACACCCAATCAGCCTACGAACAGTTAGCCCAAACAAAATAAATAA
ATAAATAAACGAAAATCGGAAATGAAAAACAGGAAGCAATCTAGGGCGTAAATCAAAATGAAACATACTTTTTCCGGAAAAGGTGCTGAGGTACCCTCCTCCTCAATACCAGCAGCCTTA
TTAGCACTCAAGCCGCCACTTTCATCACCCATCGCGCCTTTATCTTCTTCTTCTTCCTCAAGCTGTTGAACTTTTTTGTCTTCCAAACAAGTATCTCTCTCAGATATAACAATCACCTCC
TCCTCCCGATTCTTATTTAACTCCTTGATCGCCAACCTAGTCCTGGGCCTGGGTCTCGCCTCCGCAGCTTCTCTAGCTACCGCAGCCCGAGTTTTAACGTAGGTCCCAGCCCGCGGAGGC
TCCTCAAAGTGCTTCTGAAGGATCCTAGCGCGGCCTCTGCGTACACCTCTGCGAAGCACCGGCATTGTTCAAACCCATAAAAAAGTAGGTACGAAACAACGGCAATAATATGATCATTAT
CTTGGATTCAACTAAGGCAAGAAAACGTAGACATAGCGGATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGTAATTGGAGGAAAGTAGAT
GAAGATCGAAATCGGTAAAGAGTGAGTGCGAGAGATTGAATTTGTGATAGGGAAAATTCGATCTTGAGGTTGAGAGGGGCTTCAAATTGGGGTTAGGGTTTGACAGAAATGNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAACAAACCCTCTCTACGTCGTCTCAACTGTAAGATGACGTGGAAACAAGAGGACGAATGCAAATGCAAATTCGAATGCCAACGCCACCA
ACTCATCAAATCATGTGTTATGTTTGTGTAATGTGTAATTACATCCACCTCCAACATTTGGACTCCATATCTCTTATTACAACTTCTTCTTACCCTAAACCAAAGTAATACAGCTTTTTT
TTTCTAAATTTTAAACGTCAACTCTCCACTTTTAACCTTTGTAATGAAATTAAACAAGTTACATTACCTTAAGTTCGTACGTATGGTTATGGATGAATTGGGCTTATTCAAAACCATCAC
CAATCGTACCATTTAGGTTGGGCTTCAACAGGTCCACCAAACTATGCATCATTTGATTTGGAAGATTACGTTAAATTTGACTTAATCCAATCTAATACCATATGGGATTGACAAAACATC
CTACTAAAATAGGCAAGCTGAGTTTAGTTAAGTGGTGTTAGATTCTTGACATGCATCCGTCTTCACAAAATAAGTGATTATAACGAAAATGCAAAAAAAAAATATATATATCCTTGCAAT
TAAGACAATGATTCGCTCGAAATTTGACGTTTCTTGCTTATTAGTGATATCCATTGTTATTTAATTGTTGTCTTATAATTTGATTACGCCTTAATTACTATATAATGTTGGATAAGAGCA
GTTTTAAAATAAAGGAATAAACAAAATTTCATTTTTTTTTCTTTTGTCATACTAACAAAATCACAAATATGGATGACACGTCTATAAAAAAAAAATGTATTTTAAAATTGCTACCTACCA
TCAATACTTTACATAAATATATATGTTTATGTTGACTTGTTATAATTTGTCTAACTTAAGCATTCTCTAAATGATTATGATTAGATATGTATGTATACATGTATGCATATTTATTTGGTT
CGGGGTGTTTTATCTAGTTCTAGTTGTTAAACTTTTAAAATAATTGTAGATGTTGATATGAATTAGACATTTTTCACTGACCATAAATCTGTAAGCTTAATAAGTGGATGATCAAAAGTT
TAAAATGTAAGGGTGTGATTGCAACAACCCATTCGTGATATGTCTTGGTTCATTGTTTTCCATAAGCTCTCTCCACCCTCTCCCTTTTCCTCCTAACCCCTCCCTTTTCAATCCAATTGA
GTATAGCTTGGTTGTTCAACTGACTAAAGCTTATTATATGATATTGCTAGCACCAACTAACACCAGCATCATAACAAAAATGAAAGCGATCAAACAACATTTGCATCATGAAAAATATAA
GACAAGACGCCAATGTTTTCTTGTATTTCAAACGAATCAAAGTTCGAACCGTGCAAGAGAAGGTTAAGAGAAGGTTTTTGAATGTAATAACCAAATATTACCTTACTAACTAGTAAATAT
GAGAAGCATAATTATCACAATTTAGTAATAGATTAGGTTGTAGTAACAAGGACGACATTAAACCAACCTGATATTGCATAAGAAAGTCAATAAANNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNTTTACACCTAACAGTTGCAGCCATGAGTGCATCTTTACAAGACCTTTCACTTTGGTCTGTTTATGGACAGTCATTGACAATGTATCGTGAGAGTAAACGTACATGCATCCCCA
CACAAAAGGTGGTGGTGCTTACCGAGCCCTTATGACCGAATCTCTCCTACTCAAGTGCCATCCTCGAAGTTCCTCATATGATTGAACTCAAGTGACTTAGATCAACTAAATTTGGCTGAC
CTCTGTCATTGAACTCACTTGTATTACATCAACTTAGATCAGCTTGCATCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACATGGACAAT
TGGACGCTTGGCTTGAACCAAACTGTAAATCCATTTCAAAGTAAAGGAAATTCATCCGTGTAAAAACATACAAACGCCTTAAATTTTGCATCTTGAAATTAGCCGAGTGAAAGCAAGAGG
ATATATAGATAGTGTGAGCGTACGGCGTACCTGTATCTTCTATTATTTGGCTATGGAGATTGGACTCAGCACTAAATGATCCAGAAGCCTCTCGTGGTTCTCTTCATCAGTGCAAACAGA
CAATTTGTCGTCTCAAAGCTTACTTCCCACTTAGGCATTTCGTCGAATACTTGGGACGCACGAGCTAATACATAACAGTAAAAATGGATAACAAAACTTGGAAGCTGAATTTGATTCAAG
TGAATGGTGGGTATTGTATTCACAGTGTCGACTAGAGCAGAAAGACATAAAGCGTAGAAACCAAATGGATTTCTATTTTCATTAAAAATTCGATATTCCACAACGCGATCAACAAGAACA
GACATAAAACCAAAATAAGAAGAAATCAACATTTTCTGTCACCCCATTTGAGAAGGGTTCTTAGATTTGGGGAGAGAGAAATGGAAAGGAGGTGGTCGGAGCACGGCTTCCTCAGTCTCA
ATTGGATCTGACCTCCGTATCTACAAACAAAAGAAAGAAATAGAGAACAATCTTCAGTTGGTGCACATTGGTACAACCAAATTCAAGAATGAAAAGGAAAGAATTAGTAGTAAGAGTTAA
TTTGGGAGAAAGAGAGAGAGAGAGAACCGGATCTTGGAGAAGAAGCTTGGTGTCATCTTTAGCAGGCCTGAAGGGGGGCTTTTGGGGCCTTTCCTTGCATTCCACAGTATTCGATGGAGA
CGAAAGCTCTGAAGCTTTCATCCTCACCTCACTCCTTCAACTTCTCAACGCTCCTTTGATCTCAATTTTGCTGTTCTATGATTTTCTTCCCCAAAATGCACAATTTTTTTTCACATCTAT
TTCAAGTCTCTATTTAGATTAATGTCTTTCAAAAAAAAGTTATTTTGTTTAAATACTCTTTATTGATGAACACTTAGAGTATATTACAAACCNNNNNNNNNNNNNNNNNNNNNCGAGTTT
AAAAATCTTCATCATCGGATGTTAAGGTAACTGATGGGATCGTGAGGAGTCCTAAACTCTTTGAGCTAATTAGTACATTCTTAAGCACTTCTATATTAGTTCTCGTATTAATCTCTTGTT
ACATAAGAAAAATGAACGGTATGAGTATTACTCTTATTAATATAATATTAAGTTGGTATTTGGTAAATACNNNNNNNNNNNNNNNNNNNNNNNCAAATCTTTTCCACTATCCCAAAAGTT
TGAAATGAAATATTTGATTGAGATTGAAGATTAGAAATGAATCCAGTATTTTTTTTCCTTAAACAAAATTGGTATTTCGGAAGTTGATAAAAAAGACGAAAAATATTGTATCGTAAGTTA
AAATTGTGATTCATTTTTTGTTGGGACACCAAGAATTCATACACTCAAAGTTAAAAAGAATCGAACCTTTAAAAGTGGATGACTTTGAATTAAACTTTATACACAAAGATAAAGATTCCA
ATTCTCCATTTCCATATCACAGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGTCACGATTCAATTTATGATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATGAATTATTATAAGATACTTTCTGATCTAAACGATACTTAACAAAATGTGATTCTAAAATATATATAAACTTATGAAT
GGAACCCGTAGTTGCGAGTTTACTTTTTAAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACGATGTCTAAAATTAATCAAGCAAAACTTTAATAATCTCCACAAAAACAAACTTACAA
TAGATACAAACAACAAATAAGTTGTTATTTGTAACATAACAATTCCAGTGACAACACACAAATGATACAAAAATAACCAAAGAGTAGTGTAATCTAGTACAACTCAATTACAATTCAAAT
AGTTAGTACGTCGTCGATCACATAAGCATTATCTATATCCGAAAGGAAACCAACGTTGGTGGTAATGAGACTGGTGAGAGATAACATAGAGAAAGAAGACGAGGAGGATGGCGACGCCCC
AGGGTGAGCCACCAGCACGATGGAGGGAGTCCTGCTCGGGTAAAGGGAGGAGAAAGGAGAAGCCGAAAGANNNNNNNNNNNNNNNNNNNNNNNNNNNCAAGGGGACAGTGAGAAGGAAGA
GCTTGAGTTGGAAGATAAAATCTTCAAGAAATGAATAGTAGAAGAAGTACCATGAAAAGGCCATCACCACCAAAAGGATCACAACAAACACACAAAGCTGCAAAGGAGGCAATGTCAAGT
ACTCCAAGTAAGGATAGCGGTAGTAGTAGTTGTACCTTGCCATTCTCTTTCCCACTCCAAAGATTTTCCCAATCCAACTTTCTCTTCTACACTTCTCCTTTCACATGTGTGTGTGNNNNN
NNNNNNNNNNNNNNNNNNTCGTCGGTTGAAACACTCTTTGTAAATTTTTAATGTTAAATTTCACTCTAATATAATATGTATTCCCTCGTTCTCTACATACAGATATAACCAACACCCGTG
TGAACTACGTAAAGATGTGTGTCAATTTTCTACTACTTTACTTTTCTTGTTTTTATTAACATCTTAGTTTCGTACTTACTTTTAATTCTAGAAGAGACGAGCGAGTTGGAGAAAGCTCTC
TTTATGCTTTTGTTTCAAGAGCCTTTCAAGGAATGTTGATATTATAATAATAAAAGAAGCCTCCTCCATCTGTCCATATTGCCCTTTCTTTGTTTACCTCTTTATATGAAAATTACTTTA
ATTTAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTGCACTTGATAACA
AAAATAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTTAATATAAGTTTTGGTAATCTATTATTGATTTTAAAAACATAGGTTAAAAAGGTAAA
AGTTTTTTGTTATTTTGTGAATTAAGAGGAGCATATAAATGTAAAAGAAGAAAGAAAAAAGTTTGATCCTTCTTTAATCTTTTGTTAGGTATCTTTATTCCACAACTTGGACATATATAC
AAAAAAGCTTTACCTCATCTATATGCCAAAGTATATCCATATTCCTCCTTCTACGTAATTTGTCTTAAATTAAATATTCTATCTTTTATTTGTCGTTCCTCTTTTTTCTCATCATATAAA
CGTAGTTGAATGATAATTGATACAGTAATTTTTTCCTTTTAAAACGTAGATTCAAATTAAATCTCCCCGAACTATAAATTTGTTGTACTAAAATGTGTAAAGTCTACTAAGCTATACNNN
NNNNNNNNNNNNNNNNNNGATGTGCATTAAAAACAATTCTTAGAAATTTTTTGAAATAAAAAATTGAAAACTATTAACAAAATATAGGAGAAAAATTTAACTGTTGTTATAGTTTGCTAT
ATTTGTAAATGAATTATCAACTATTTAAATTTATTTGTTCTTTGTTCTTTTTTTTCTATTTATTTTACCCCACAATTGTTAATAATAACAATAATAATATCCACAACANNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGTATTGTTGTCATCGTGTAACAATGTCATAATATAAACCTCATAATGTAAA
GATTAAATTAACTCCTAATTTATTTTAAGATAAAATGACTCGCGTTAATATTTAATAATTAAAGGGGTCAATATATTCAATGATCTAATGGATAATCGTTGTCAGACCCTTCGTCACATT
GAACCTATAATTAGATCATATGGAACAAAATTTAATATTCTATCTCTTAAATTAAACAAATTTTAGGGTAAACAACAAAACTACTATTAATTAACGTGTTTGAAGGGGCTTCTAATTCCA
AGTTCTATCTTTTGAATAATACAATACAATATTTAATATGTAACTAAATAATTCAAATCCTTTGTTTAATCCATAACTTAATCAAATACCCTTTCTTTTCTCATCGAATGAATTAACTAT
AATTTAAAAGTCTTAAAACTTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGTTTATTAGAATGGTCTAAGATTGAAAAATATTTGAATTGGTCAAAGATT
TGCAAATATTAGAAGATTCGTAAATGGNNNNNNNNNNNNNNNNNNNNNNNNNNGGTATGTATTTGACTTTTTTTTTCAAAGTTTGAAATCTCATAATTAAATTTTAGAAAATAAAAAGTT
GGAAATTTAGAACACAGTTTCTAAATAACACTAAGAATGAGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGAAACTATTCA
CAAGAATAGAACAAAATCCACTAAACATTTAAGTATGTTGCNNNNNNNNNNNNNNNNNNNNNNNNNNGCAATTTTCCTTATTAATTATAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGAGATTTTACNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNGCTATCTCTAATTGGGTTTGGAGGTGGAAATGATTGGAGGTTATTTTTGGAAAACAGGAAAGAAGTAGAAAGAGAATAAGGAACGTCATCATGATGAT
TTAAAATATTTAATTAAACCCTTAACTGATAAAAAATAAAAAATAACAACATATAAACTAGAAAAAAGAATCATATATTATAAAAAACAATCACATGAAAACTAACATTATTGAGATTTG
GGAAAGATAAGAGGAAATAATACAAAACATAGAAATAAAGAAAAACACGTGGAGAGAAGTTTAATTTAAAAATGGACTATCAATAATAATGCAATACATAAATATCATATTCAACAACAG
CATCCAATGTAGTAGCGTTGAAATATTGAGTCTTAGCCAGCGCATGACCTTTAGCAAATCGGAACCGTCCAGTTCCTCCCACCACTGGCATCTCTCGTACTTGGTTCAGAATAGGGTTCC
GACCCAAAATGGTGATGGAGCTCCCCTTGTATTTTCCGTAAGTAAACGCAAAGTTCATAGCCATCAAAAGTCCAATTTCATGCTGTGCAGTAGAGGCATACAAACCTTGAGATCTCCCCA
CTAGCCGAGACTTGGGGTCTGGTCCGACCGTCAATGGGTTGTCAAACATGTTGATAAGCCCAAACAATGTAACGTTATTTAGGCGTGGCAACACCGGGACGCTAGTGGGGTTGCTTCCGC
CCACCACGTCGTGCCAGTAAAGATGAAAACGAGTTAGCTTCTCTTTCTTCAGTTTCAACACCTTGGGGTTCAGCCTGGTTGCAAACGAGTCGTCGTCCGAAGCCATGGCCGAACTAATCA
AGCACCAAAGAAGACAACATGTGAAGAAGAACTTACTTCCCATGCCTGCAGGAGCTAGCTGCTACAAAACTTCCAGACTTGGAGAATAATGAGAAACCTTGAGAATAGAAAGGGGTATAT
ATATATATAATATACAAACCCAAATGGCTTGCCAAGTGATGCTAGGGGAGGTGTGAAGGGGCAAGCCATGTTTGACTTGATATTAATTTTTTTTCGTAAGATCAAGAGAGACTAATATTA
AATAGTTAATGGCTTATTCATATACACAACGTGTGCAGTGATTTAATTATTTATAATGAGATAAATAATAATGCATTGATTATTTAATCATTATATTTGAGGAATTTAAAAGCTTAATGT
GGTTAATTGTCACTAATACAAAATATTCATTGGCTACTTTTGATCTTTAATCTTCTTATTAAAAAATTTGGTCACTTTCGTAAATACTTTAATTAAAAGCTTAATTACGTTTTTCACTAG
AAATTTTAGTAAAGAAGAATAATAATCCATGACTCGTGGAATACATGTATATATATATATGAAAGAGCTTTGAAAAAATTTAGAAGATTGTATGATTATTTAATATCTCAAATGCATCGT
TTTTACTATGAAAAAGATAAACATCAAATAAGGAATTTATCAAATTTACAATTAAAGACATGAAAGGACATCAATATTAGTACATGACTATAGTTAAATATAACAGATTTATTAGGAGAT
CAAGGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTGGTTGTTTATTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACGTAGTATATATTGCACCCTACATGAAT
GCAAAGATAAACCCAAGCCCCCTTATGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAGAATTCAATAGTGAAATACATAAATGTT
ATATTCAACAACAGCATCTCCTGTTTTGAAATTGAACTTCCTGGTTGTGGCTTTTGCATACCCTCTCGCAAATCTGAAAACTCCACCTCCACCGATCACAGACATCTCTCTCACTTTCTC
CCCAACTGGGTTTCTTCCAAATATAGCGATTGAGCTTCCGTTGTATTTCCCACTCACAAAAGCCAAATTCATCGCCATTAACAGACCAAGTTTGTCTTGCGAAGCTGATGCGTAAAATCC
CTGTCCTCTTCCCCATAGTCTGGACTTGGGATCTTTAGTTTCTGTTAATGGATTGTCGATCATTTGGACTGCACCAAATCTAGTCCTCGACGTGTTCGGAACAGGCGCCACTATTTGGAC
TGAGGTTGGGTTTTTGCCACTTACAACGTCGTGCCAATATAGACGGAGGTGGCTGAGCTTCTCTTTTTCAAGACCCAACAGCTTTCTATCCATTGTTCTTGCAAAGGAATGTTCATGTTC
AGCGATGGCGAAGGAGAGGAGGAAAGAGAGAAAGAGGAAGTGGGTGGCCGAGATAGGAGAAATTATGGCCATGGAAATGGAGATCATTGGACTTGAGACATACAACCGCGCAGGATATTT
TCTGCCTTCTATTTCTATATATAAATTAGCGGTAAAGCCTCATTACAATTTCTCTCCATTTTCTTTTGTTTTTCAGTTCAAATCATAAAATGGAGTGAAATCAAAGTTTTAACTTTCAAC
TCATAATGGGAATTGGAAACTAAATTAACCTTAGCACGTTATATACAACTATAGTCTTTGTAAGTTCATTTTTGTTCTTTTGAACTTCAGTAATTGATGCAATTTTGTTACTATTTTGTG
AAAGCTAAGGCTTAGAAGTTGAACTGTGGTTGCTGAAATTAGAAGTAATTGAATTCATTGAAATGAAATTGAACCATCCCATCATCATCAACCAATACGTGTGTTTACACTCTTACAACG
TCTCTATTTCATGGGAGATTCAAATTCAATCCTTAAGATGATAAAATATGTTAAGGAGAATATTTAAAATTTAAAACTTAAAGATTTGTTTAACAAAACAATTTTGAAATCAAATCAATG
AAAGAAAAATATATAGCAACTTTAGATTCAATATCTAATGGCTAAGGCAAAAGTATATAGTGGAGACCTTATCATTACTATGGGCGATGGTACCATATCATTACCTTTTGGTAAAACTTA
AATCATAGGGTTACTGATTTCTATTTTAAACAAAAAAATAATGCATTTTTTTAGATGATCAACAAAGTAATATGAATTTTCACTTTACTTTGACTCAAGTAGATGATCAAAATCTTATGC
TTGAAGAAAATCCCACGTAGAAAAAAAAACGAAATAACAATCACACAGGCATCTCTCTCGCAAATCTAAACAGCCCACTTCCACCAATCACAGGCATCTCTCTCTCACTTTCTCCATAAA
TGGGTTTCTTCCAAATATGGTGACGGAGCTTCCATTGTATTTCCCACTCACAAACGCTAAATTCATCGCCATTAACAACCCAGATTGGTCTTGTGAAGCCGCCGGCCACCGCCGCGTAAA
AACCCTGTGCTCTTCCCCATAGTTTGGACTTGGGAAGATCTTGAGTTTCTGTTAATGGGTTGTCGATCATTTGAACTGCACCGAATCTAGTCCTCGACGTGTTCGAAACAGGGGCCATTA
TTTGAACTGGGGTTGGGTTTTTACCAGTCTGAATATCGTGCCACAGTAGAAACGAAAAAGTTCCCTGTCCACTGTTCTTTCAAAGGGATGTTCATCTTCGACTATAGCCAAAGCTACGGC
GGAGGAGAGTAGGAATTAAAGAGAGAAAGAGGAAGTGGGTGGGGGTGGGGGTGATGGGAGAGATTCCAACCACATGGAATGGCAGATTTCAAAGTTTCTATATAAACTTAAGCTATAGTA
CTTACTTTTAGCCATTTTAATTTATCATTCATTTGCTTTTCTCTTACAAAATTATGATCCAAGAATGTGAATCTGAGGCCATATCCCACTCCAAGNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAGTTTTCAAGTGAAGTGGGTGGTGAGTGGGTCATGCATGCATGATACACCTAACATTATTAAAGCGTCATTGTAAGTTCTCATTTTC
TTTTGTTTTTAGGTTGGTTTAAAAAAATTTAACTTTGGAGAAGGGTATAATTTAAATGTTAATCTTAACTTAAAATGGGAATTCAAAGTTAAATTATGTACTTTTGTTATTACTTTTGTG
TGGGGGCATGAAATCGAGTGTGGTTGTTGGAATTATTGGAAGAAGTATTGATTGTTTGTTTAATCAAATTGAAATTGAACAAACCCATTAACATATGTTTACACTCTTAAAGGTTCTCTT
GTCTAACCCTCCACACTCTTTCCCCCATATAATATAATATGAAACCAACTCAAAGAATGTAAAAGTTATATAGTTCTTAATATGTAATATCACATGGTCACTTGAGATGATATGCGACTA
AGGCAAAAACTGTTGTGAAATAATAAGGAGATGATAATCGTTCAAATTCAAACTTATGTTAATAAAAATTTAGATTATATATAACGTAAGTTGTTCAATAGATTTTCTCCAAAAAAAAAA
GTTTGTTTATGGATCGTCTCCGACAAACAATATTTCTCAAATATCTAATGATTTTTTTAAAAAAAATGTAAGCTTTACTTTTAAATATTTGTTCACCATCTATTTGATTACTTTTAACCA
ACGTGGGATTAGATTATTATGATAGACATGAAAGTTATAGTTCAACCAAACATCTAAACAAGTCTACGAGATATCTGATTAGACAATCTGATGATCAAATTCTTGAAAAGACAAGAAGGG
ATTTAGATTATACACTAATGCAAATATAATGTGATTCTAAACAGATAACTTTTTACTCTCAAATTAAATGTTTAGTTTTTCACATTTTTATTTCTTTTATTTTATTTTACTGATTTTAGA
GTGCTTGCTAGGCAGTGCCATAATTAAATGATATGCAAATTTTATCTTTTATAAGTTTTTTACTATGGGTGTTGCATAAATATGATCTAAACTTTTCCACGAACCTTCTAAAAGTGATGT
CAAATTTTGTTTAACGTCTATTGCAAACTTTTGAATAATTTGACATTAACCTCCAAAAATGGGTCTATTGCAAATTGAAAACCTCACTTTTGACCTTGCATCTCCATACGATCAAATTAA
CAAAATTTCATCTTCAAACTATTAAATCTCGAAATTGTAACATTTCATCTTCAACATTTAGGAATTGGAGTAGCTCTCAGCTCAACATACGAACAACTACATAGGTACAAAATTATTTCT
CCACAAATTTTATCAAAAAAGAACACACATGGATTTGATTATCTTCCCCATTTCCATCCTACCAAAAGGAGATATTTAATTGATGCTACACACCTGATTTTCCCTCAAGAAAAACCTTGA
TATTGAGCTTGGTTGCAAAAGCACTTTCACAGGGCCTTACTCGGTTTCAGCCCACTCCACAGCACTTTGCCCATCTCATCAATTCCTTTCTCTCTCTTTTCTAAATAACAAAATTTCATC
CATAAAATAACCAATACTTTTAGCTCTTCAAAAAATATAAAATCAAACATGAAAAAAAAAGAATACGTTTCAAAGTAATTTTAAATATGGTAAAAATGATTTTAACTATTTAATACCATT
GTAGTTGTAAAATTATGAAATGAGATAAAATGAGTAATGAGAGTTATTGAGATTCAATGCATAGACCCAATGCCACACATAAAAAGTTGGTAAAGCAAAGAAGTTGATTTCAATAAAAAA
AAAAAAAAGAAGAAGTGTTATGAATTTGCAATAATCAAAGTATTTGGTCTAAAGTTATGACCTCCAAATTAAATACAAATATTCTTATTCTTATAATTTTGTCAAAATAATAAAATATAT
GTATGGCTGATAAATTAAAGAAATGGTTTGAAATTAAACTAACAATAATTGATGGAGTTTTCTCTTTTTATTTTTCTTATTTTTTGTGCCATGCAGTCACGTCATTGCTGATATAAACTA
CATGCAAAATAATTTATTCTTAACAAAACCCCAAACCAATTTTTTTTACTTTTACCATATTTTTTTAAAATTTGTTATCGTGAGCAAATCTGTTTTTCTAATCCAACAATCAACTAAACT
CTTCTATAAACAAATTAATAAGCTCCTTTTTAATTTTGTTCAGTGTTGTTTACTCTAAAGAGAGGAGGTTGAGAAAGTTATTATCATTGGATATATATATATATTTCTCCATAAAGACTT
CATGCCTTGATATGTTTACTTTCTTTCTTTTACTAGCATTATTGGGATTGTTAATTTAGATGTATTGTACAGTGTGGTATTGGTATTGCATCCTAAAAAACTCAAGTGATGTTGTTTTCA
CCTCAAAGTGCAAAATCCTAAGAATGTGGGAAACCCAATAGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGCTTACAAGATTATTGTGACAATATATCATGATGACCCATGAATG
CATATCATGATTTGGTTGGGGTTGGATTGAATGGGTGATTTATGTTATACACAATTGTATTTCTAGGCTAGATTTGCTTTTATTTCTTCACCACATGTTGTTAATGATTATTAAAAAAAA
TGTGATTTACTTCTCAAAATTAATAACACACATTAATTTGCATTTGCAGTAATGATATATATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATAC
ATCAACATACGAAAGATTGAAAATAAATATGGAGTAAAACTTAAAAGACTAGTTTTTTAAACTTAAAAAACTAAATATAAACTTAGATAAAAAATTCACAGAATTCAAGAACTGAAAAGA
TATAACTTTTCCTAAATAAATAGAATTGTTTGAAAAAGAAATATTAAATAAATAGAAGGAACGACATCAAAGGAACAATCGTACGTCATCATACACATACTTGGACGACACGTCGTCTTC
AATATTTTTCAATTTCCTACCATTGTTTATCACTCCATTATTTTTCATTTTCTTCCACAACAAGTAATTAATTTCGAAACTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATATCAC
ATCTTCTAACACAAACTAACAAATTTTTAGAGTGTATCCAATATAAAAACTAATATATATATATATGAATTAAGTAGGTAATGTATAGAATAAACTTTAGATACTTCCTTTTCCAAACAA
TTCTTTTAATGGACAGCTAAGTCGGATTAGAATAGTATAAATTAGTTAAGATTAGGGTTTGGAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATAATCAAGATTTGCCTAATCAAGA
ACTGATAAAGTAATATATGATAGTTATCTAAACCAATTAGGCCTTTTGCATCTATTTATATACAATAATCAACCTATGAATTTAATTATATACACTTCAATATTGTCTCTTTTGTTTTTC
AAAAGTTAAACAATTATTCCTACCAAGTATTTATTCTCTTGCCTTTACTCAATCAATCAAGCACAAATATACTCAACCACACTTTAATTATATTAACACGTGCACATGTGAGTTTAAATA
GAGTTCGATGAATATCGTTTCAATTTTGAATGGTATGTTTAAGTTTATAGATTCCACCTTTAGTTTTTATGAAGAGTACTATTTAAGACATCAAAAAAGCACCACAGTCATTTGTGAGAT
GACGCCTCTATTGTCTCACTAATTAACTTCAAGGTTTTCCTCTAGCCTCCTATTGTTTCCTGTCCTCTAACTCTTTTCGTACATATTATGAATGTCACGTCACACATATATCGTTTTGAA
TGAATATATCAAAACGATACTAAAAATGTGTTAACCTAGTTGAAGTATCTAGTGTTCTACTTGTAGAAAGAAAATCGAAAGCAAGATTATTATCGATCATAGTGCCCTAGTTGAAGTATT
TGTTGTTTTGTATTATATTTTCTTCTGTTGGGTATTTCATAATTTGACTTATAATTGAGAAATTCAGAGGCAAAATTGTAATTGATCACAAATAATTTTTTTTCAAAAAAGGTTGCCTAT
TGTTTTTATTTTCTTGGTCTACACAAAAAATTAGGTAATTAAAGGTAGACTTGAAGGCCTCACACCAAACAAAGCCCAAGAGGCTGCGAGCTTGAGTTGGCCCACTAATCCTTCTACTAC
TACACCTAATCAAATACGCAACTCTCTATATTTGGTCAAACTCTCAATTTAACTCAACCCATCCTAAGCAAATGTATTTCCTTTCATCCACTTTCATAGTCCTATCAAATTATTCAATTA
TAGTTAGTCATCAAACGTCTTACTAAAACAAAATAACAAAATAAAAACTCATATTTTAACCAAAATTTTGTTCATTTAGACTTGAAATTATAATCATTAAACCAAAAATTTTAATTTGAT
ATACATCTTAATTGAATTTTTTGATTTGGATTGGTTTGGTTATGGAGCCATAAATAGCCCAACATAAAATGCATAAAAATAAGTGTATTTTGGGATATATTAACTATTTGGTAGCTCTTG
TGTGATGTATCTCTCTTTTTTTTCTTCTTCAGACCTTTAACAAAATCAACGTTGGGAACCCTCTAGACGCTTTGACCCTTCACTTATAAGTTACATTACAAACTTTACAATCCACCTCAT
AATTCTCTCACCTCCCTTCTTCTCTTCCCTTCCAAACTAAAGTTGGTTGCTCTGTTTTTCATTTTTTGGGGTTGGTGTGTGCTCAAAAAACAGAGCATATTAGTGATTGATTGATACTAT
TATGGGAACTTTAGTGGGTCATGTAGCACCCGGGTTTGGCTTCTTCATCATTGGCCTATGGCATCTCTTCAACAACATAAAGATCGAAGCTTGTAACAACAACCCTCCAAATACTGCCAT
ATTTCTCTCATGGTTCCCCACTTCAAGATTCAAGTACTTAGAGCCGTTTTTAATTATGGTTGGTGCTTCTGCCTCTATAGCCATGGAGCTCTTCATCGGCCCACAAAGACACCAACCGTT
CGATATCGATGGAACCATCCCTTCTTACCATCTCCACAACTTCGAACACTCCAACATTTCTATGACTTTCTTTGTGTTTGCTGCGTTTTGTGTTGTTCTTGATCAGGTTCGTCCTAAGGC
TTATTTTGAGCTGACACAATTTGTTGGCACAGTGGCTTTTGGACAAGAGCTTCTGTTGTTTCACCTCCACTCGGCTGACCACATGGGCCCCGAAGGCCAATACCATTTACTTCTTCAGCT
GCTTGTGGTGGTCTCTTTTGCCACAACTCTACTTGGGATTGCTCTTCCTAATAGCTTCTTGTTGGCGTTCGTTAGGTCTCTTAGTATTGTTTTTCAAGGCCTTTGGCTTATTCTCATGGG
CTTCGCACTCTGGACGCCTTCTTTCATTCCTAAAGGTATGAAGCTTACTAAGTTGACAAATAACATTTTTTTTCTATTAAAAAAAAAGTGAAAGATTAAGCTTCTTGTTTGTTTCTATCT
TAACTTCTGTGTTATCTATAAAAAAAGATCTAATGAATGGGTAATAAGACAAAAGATATTTTTTACAAGTTTTTGTTTTTATATGAAATCACTTTTTCAGTTCCAAGGTTTAAATGGTTC
AATTGCTATGTATTTAATTAACAGTATTAATTTATTTATGGGGTATATATCATTGTTAGTTCATCACTAAATGTATAATTTTATAACATAGGTTGCTTTATGCACTTGGAAGATGGGCAC
AAGGTGGTGCGGTGCGCTGGGGACGAACCACTTCACCGAGCAAAGTCGTTAATCAACATTCAATTCAGCTGGCTATTAATTGCACTCACCATTCTGAGTTTATCATTTTATTTGGTTCTG
CTTAAACTATACCAACAACAAACCCCCGACCCCAAGAAGAATAATCCAGTCCAATACTTTTCACTAATCACCAACGACGACGAAGAAGAAGATGCTGAAGCAGCCACCTCAACACCAACA
AAAACATCATCTTATAACGTCGTTTCCGTTCCCAAAAGCTTTATTCAAATGGGCCATAAGCTCGCAGATACAGACATGGAAAGATAGAAGCAAAGATCACAAACCCAAATGGATAAAGCC
GCCAGCTTAATTATTCAACTTAAAATTATTTGGTCATTGGTGTGTAATCATGTGTACAGTATATATATATATATAGTTTGTTTGTATTTATAATTCACTGTGTTGTGCTTTGGTTTGGAA
GTAGTTTCCACATCTTTCCTTTTCATTTTTTTGTAAAATTTTAAGCCAAGCTGAAACTATGTGTGAAAGAGCAGGCTTATAAATTAATTAGCTTAGGTGATCAAAGCAGCAAATTACCTA
CTGCAACCTAAATACGATCCATTATCAATACCTTTTCGTGTTAGATTTTCTTTTTCCTTTACTCCATTCATCTTTCTTCAGTTATTGGATTGGTGTTGTGACAAATTTTGATGGAAGAAT
TAACGACTAGGTAGATAATATTTAAGGAGAAGATAGGTAATGGGGGAAGGTGGATGGTCACCAGAATTAAGTGTAAAGTACAAAGGTTTGGCAACTTGGCTTTGACTCAAAATTTCACGT
TCTTCCCATTAGCCATTTCGTACAAGCCACACCTGAAATGGATGGTTGAAAACGACCATTCCATTCCATTATTATTTTCAGTTCATTTCTAATTCCATGAATGCAATATTAACTTATTAA
ACTCATTAATTTGATTAATACTTTATCATTAATTTAAACCACTCATGTTTTGAAAACACACATGTACCCATCTTCTTCATTTGTGTGCAACTTATTCAATTCTCCTAAGTATAGATATGG
TATGGTATGTAACAAGTTTTTTCTTTCCTTCTCGTATAGATGGAGTTGACTACTATAAAAGATACAAGATACATCAAAATACTTTGATTCAATATTCTTTTATCGAACAATTTCAAAGAA
AGTTAAAGTTTTGTTTATTAATTAACAGAAGATGTAATATAAACAAACCATTTCGTTCCGTTTTTTTCTTTCCAATTTAATGTCTAAGAGTGGATTATTAATGCAGGTTTTCCTAGATAT
TGATAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATAACAATTTGGATTCATATACTAATAATGATGATATTCTTTTCATCGTTTGCATTAATTATTTATTAATCACCAA
TATTTAAGAATTGATTATTGCTATCGTAATAGTTAATGTTTCGGTGTAAACTAAAGGTAGAAAATAGTAAATTAAATTTTGTGTTTTATCTTTTTTAAGGTATGGGTAAAAAAAGAGTGC
AAATTACACAGCAAAACGACGCGTCGGCTTGATAGGAAGAGAGTGAAACGACGTCGCAAGAAAACTGTCGCTCCGAGTTCTTTTGGGAACTGCCGCTCCCCCGGTTGTCCCCGAGAACTC
CGGTGCCTCGCTAGGGTTCGTAGAAGCATTAAATTTTATGCCTCGAATTGCCGTTCCGATTCTCGTCGTCGTAAATGGAAAGCTCTGACCCCGATGAACCTGATAAGAAGAGGCCTCATT
TGAGCTCGCTTACCCCTGCCATGGCTCGCAACTCCACCACTTCACAACCACATAACAACAGCGTAACTCTTTAACTCCACTCCGATATTCAATTCATATCACCTCTCCTTTCTTTGGACA
CGTACTTCGTTTAAACTCTCTTTTAGTACTTATGGGCAGCTATTGGATTTCTGCGTCTCCATTTTACTTAAAATTTCGTCATTAGCGTTTTTCATTATGCTTTGTGTTTTATAATTGGAA
GAAGGTTGTTTCTGGGAATGAGCATTGAGCTGAAAACTAAACAATTTATGGATTTTGGATAATTTCCCCAACTAAAAAATCTCAATTTTTTTTCCAATCACAATATGAAGCTATTTAATA
CGATTTTCTTCATTTTGTGCATTGCCATTCATCGTGGTTAGTTGCGTAGATACAGTGGTTTTTTCTTTTATGAATTCTTAAATGTAAAGCCAGGTTCTTTCAGCTTCCCGACCTGTGCCT
GCATTTGCGCATCGAGTATTTACTCTTTTAGGATCGTATCAAACAAACATCTTGTTGTGTTGTTACCGCTTTACCATAGAATCAGAAATTGAAGCGACTGTTGAGTATTTATTTATCAGA
TAGAAAGCATGCTGGCTCGATAGTTTAAAGTGCGAGTTTGTAAACTTGCCTGGCTTTGGAGTTCCAACAACCGTGGGATTTGTATCTGATATCATCTTCGTTTTTTATTTTCTTCTGAAA
GACAAGCTTATTTACTAGTCATTTTCTTGGTTTTCTAATACTTCCAAAGTCATTTGCATTTTAAAAGCTTAAAAAACAAAAGTTAGTTTTCCAAAACCTATTTTTAATCTTTGGAATATC
AAATTTTGGATTTGATTTAAAACAAGGGTTTCAAGGAAGTGAAAAACTGATATAAGAAAATTTGAATGATTCATGATTGTCTATTATCAGCTCAATTTTGAAAAATGAAAAAGAAAAAAA
TGGCCATTTAACAGACTTTAAGGTGTATGATTATTTTGAGCTAGAAACCCATTTTGAACACATAACGATTTACTTAAATATTTAAAGATCTTTGACCATCATGCCAGGTTGATGCAACCG
TCCTTCATTTCCAGAATCAAAAACTTGTCCAGGAGACTGACTCTCAAAAGCATGAGCTGCAAGACCTTGAAGCCAAAATTTATGAATTGAAAAAAAACAGAGTTTTTATGACGAGTCATT
GATTGCCATCAACCAACTCTGGAATCAGGTGATGATGCTTAGATATCCTTTTCCTTCTGAATTTTCATGTAAACTTCCTGTTTTTCCTTTGCATCTGATCTTTTTCTCTCTATTAGTTGG
TTGATGATTTAGTTTTTCTTGGACTACAAGCTGGAGGAGGTGGGGAGATCTTACAAAATTTAGGACAAGCTGGCCACTCTCAAGGTACTTTTGGGTTATAGCAAGTTCACACAAACACCT
TGCCATTCAAATTCTTAACTTTACTCTCTCAGTTTCTTATGAAAGTAGAATTGAATTTTGTTTTCATTTACATTGATCGAAGTACTTTCTAGGTTCAATTCCTTCATGTCCTGCGGAGGA
CATGTTTCTTTGTAGATTGCTACTGAGGGATTCTATTGAAGTCAGACATGATGAACAAATTGTCAAATACGTTAAAGAAGCTCTTACTTCACGACATGCATCCACCATGGAGTTGTTTAA
ATACTTGGAGGATATTCTTGATACGCAAAGGGAAAAAACTGCAAACATAGTTTCTGCTTGGAATGTGGAACAATCACCAGAAGGTTAGAATGATTTATTTATTTAGTATAGTGAGATTGC
AGAGATGAGCGGTTGCCAATTATGGACTTGTGCTCCCCACCAACCTGTGGAGATTTGCCACATATATTTTTTTAATTCAATAAGTTAATCTTATGCTTAGATTAGATGTAGGAAATTCAT
TTTTACTTGAATGACAATTGTAGAAGCAAACTTGTGATAGTGCTCTGTTATTTGATCATGCGCTTTTTAGATGCTATCGTCCATTTGTCAAAGATCGATGAGATGATGAAAGAGGAGGCT
ACCAATCTAGGAGAGATCATCAAAATTCTCCACTTGAAGCATAAAGCATATGCTGACGAGATTCAAACTTATGCCTGCAGTCATTTGATGGATCAAACTGAAATTAAACGCCTTTCAGGT
CCTTGAGGCATTTCTTTCCCCATATTTTAAGCTTCAATGCAATGTTATTGTTGGAATAATTGTTTCTTCGAGCTTGAGGTCTATCATTAGATTTAATTCATCTCTTATTCAAATCTGAAG
AAGAGATAAGAACTTTTAATCCATTGTTATTAAGTTTTCATCTATTGACGGACTACTTTTGCTTGTTGGTTATAGAGGAGCTAGATGAGAGTATGGCTGAACTTGAAGAATGTAGAAGAA
AACTTGTTAGTCTTATGATGCAAAAGGATGTTACCATTGCAATGCATGTTCCCACCTTGGGCGTAGTGAATGGAAATTTATCACCTCAAAAACCTGCAGAGAGAACTATAGGATTTCGGG
AATTAAAGGAGTCCATTGAGGAAACTAAGGTATAGTTGTATGATTAGTCTCTCTCTTTCTCATCCACACAGGTACCTAATCTCATGAAATGATAATATAGATATTGGCTGCTGATCGTTT
GTCTGAGTTTCAAGATGCCTGGGAAGATAATTTAACATTGTCAAGTCAACTGCAAGATCTTGAGGTTTATAATCTTATTCATTTTATACCTATTTCTGGGACTACTCTTCCATATTCACT
ATTTTTTCCTTGGTGAATTTTGAGTATTTTCTTTATTGTTGAAGAATGATTGGATGGATGAAAAGTATGTACATTCATCACGGTTGTACATTTTACTGAATGACCAACTCCAACATTTGA
CCGCTGAAGTGGATCGTTATAAATCACTGACCGAAGCTTTGCAGGTTAAATAATTTGTCTCAACTTCCATGTTATTTGATATTCACCATGATACGAGGTCCTTTTAAAATTTAGATTTCA
GACTGACAGGTCTCATGTCATAAGAAGGGAGAAAGATTTGAATGCCAAATTGGAGTCTGTAGATGTCGCAAGGAGCTCCATGGACAATAACTGTTCTCGGATTGAGGAGCTAGAGCATCA
GCTGCAGAAAATATTGGTGGAAAAAAATGATTTAGAAATTGAAATGGAAGAGGCAGTTCAAGATTCTGGTAAGTTCATAAGATGTTATCTCTTTCTTCCTTTGGTATTTAAATATGTTAT
TGATTTGTAAAGGTGTTCACATTCATAGCAAGGGAAGATATCAAAGGAGAATTTCATGTAATGGCTTCAGCTTTGTCTAAAGAAATGGGGATGATGGAATCTCAGCTAAAGCGTTGGAAA
GACACAGCTCATGAAGCAGTGTCTATACGTGAGAAAGTTCAGGCACTTGAGACTTCCTTAGCTATGAAGGTTGGATCTTACTCTTTTATCCATCATATCTTTGGTAGTTTGGACATATTA
TTCTTCTATTTCCTATGAAAGTATACTTATCCATTTGAAGCTAACCATTATTGGTTGGTGATTCAGACAAAAGAGAAAAAGGGCTTAACTGACATATGTGCTCAACAAATGATGGAGATA
AAATCCCTCAAGTCACTGGTAAAGTTCTCTGGGCTGACCATTTCTGTCTTGTTATTCAATTATTTTAGGAGTTGAAAAGTTTTTAGGCAAGTATCAATTGGAGATTATTTTATTCCTTTG
CGAGTCTTCGTCTGCATGGGTACTCTCTCCTCCTGCTATATGATGCGAAGGAATCCAATTCTGTTATTCCAATTGATATGACCTTATTCATGCTACTATCTTCTATCAGATCCCTGTTTT
AGTTGAACCAGATTGTATTTCCTTTGTTCTTGTTTCATCAATTTCATCATCACCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGGATTTTTGTCCTGACTGCAAAATGGT
GGAACACTTGAATCTACAAGGGTTGGAACACTAACAAATCATCCAATCCTTGGCTTCATTCAAATTTGTGATCAGTTTAAAATCTGAAAGGACAGGGAGGGCTGCTTAGGAGTCGCTGAA
CATTCGGTGTGGTCAGCTACTTGATGTTTACAAGCGAAGAGAATTTTCATTAACATGACAAAAGTGTTACAAAAGTGCTACAGCGTCCTATTTATACAACCAAGGACTAACAGCCTCAAA
AAAGAGAATAACCAGCTGTCAAAGGCTTAAAACTTTCTAGCTCAAGTAAAATGAAGGGGTAATACAAGATTCTAAGGGGAAAAAAAAGAGATTTCCCCGAGGCGNNNNNNNNNNNNNNNN
NNNNNNNNNNNNGGTATGACTTTTTGTTTCTTAACCAGAAAAGAACAAATGATCCTCTCACTTCCCTAGTACTGAATAATGCAGAAGTCCCCAGGTGGTTTAACTTTACTTAGAGCCAAA
GCCTGAGTAATCTCTATGCAATTTTGAAGATATCTTTAATGCTGGAAGCAAAAAGTATGCTTATTTATATTTATTTTATTCTTAGATGATACATAGAATGTAGGACTTCATTTTTTTAAA
ACTTCAATTATAGAAGAATTGTTTCTTATTAAAAAGAATAATACAGAAGAATTGAATAATCACATTTTCTTTCTACTAGTGTGTAGGTTCACTTATTTGTATTATTAGTGTAGGTACATG
GATTTCATGCTGAATTTATTCTGTAACTAACGAGGATTTCCATCCACAAACAAGGAAAAAAACCCGGTTTATGGTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAGGAGGATTTCC
ATCCACGAAGACTAACTAACATGGATGAGTATTGATACTGCAGGTTGAGAAGTTGCTAGAGGACAAACTTGAGCTGGAATTATTTTTAGACATGTATGGGCAGGAAACTTATGATGAAAG
GTGCGACAAATTTTTTACTTTACCATCATTCTCAATTCATTATCAAAGTCTTGTTGACAGTCAAAGATGGGTGCCGCAGAAAATAAAAATAGGCAAACTGGCAAAATAAATGATTGGTAG
ACAATTTCTGGCTTGACGTGTACCACCGTCTGAATAATTCCACAATATCATTTTATGGAACTGGATCCAAGTATCTGATGAGTATTGAGGCTTTATTAGTTGGTAGGCCTGAACACATAG
TAGAAATGTACAAGATAATTGGCACAATGAATCCCCTCTATTGGGATCTAATTTTCAGAAGAAAGCTTGAAGATATCAATTCTCTTATTTTCTTGATTTCTTGCCAAAATCTCCATCTAA
AGACAAGAATGCGGAGTGTGGATAGCAACAGTACCATTCGTTGGAAATTTCTCCATCTTGCCAATTTTCTCAAACCTGTCATTCCTGAACACATGACAATGCATCAGAATTTCCAGTTTC
TCCTGATGGAGATATCCTTAGCAAAGAGCACTGGAAAACACAAATAATATTTTCCTTCATTGAAAATTTGCAAGTTCTCTGTAGGGCAACTTTCTTTATAAATTCAACATCGCTTGGAGC
CTTCCTCATCTGTAAAAGATTTGTGGGATAAAGTTAACTGTCATGATGTCAAAAGAACAATGTTTCTCTTTTTTGGACATATGGAAGGAAAGTAACGCCCCAGCTTTCAATGACACTCAC
AGGGAGAATGCTGAATGTTTTAAACTGGTTGTTAATTACAGTTTCAGTTTGAGTCATACGATAAATCAATTTTGGAAGTATTCTTTAGTTTCATATAAATTTTAACTCTTTTGAGTAACC
TCCAAGTTCTGAAGGGGCTATCTTTTCCCTGTTTTTGAGTGTTATTCTTTTATTTTACTGTATACAAAGTTTTGATATTATTCCAAAAGTGTAAAAAAGAAACTTCAGAGAAATAGGGTT
TCTTAGTGATATTATTCCAGTCAGAATTTGAGACATTTTATACATTAGTCATCAATTGTATTGTACTTCTCTGTCTGATGTGGTTTTAAAATTTTGGGTTAACTTATTCTGTGTCTTGAA
CAATGGACGGGACCTAGTTGGGCATCTTTCCATTGAAGTGTGTGTTTTATACATATTAAACTTGCAGGACATTGTGGTTGCGATTGAACTGTTTGAGTGACTACATTACACTGTTGTGCT
GTTGTCATATTACTATCTCCTATATGAGCTATCATGGATAAAACACATCATGCTTTAAATTTTATTTTAGAGATTTGGTGGAGATCAAAGAATCAGAACGCCGAGCTTGCTCTCAGGCTG
ATGTTTTAAGAATTGCTTTGGATGAGCATAGTCTTGAATTGAGAGTGAAAGCTGCAAATGAAACTGAAGCTGCTTGTCAACAACGGCTTTCTGCCACTGAAATTGAAATAATGGAGTTAA
GATCTAACCTTGATTCTGCAGAGAGGTTTGTTCTTCATCTTCTACTTATTTGTTTATATTTTTTCATTTACATATGAATGTAACTTCTCACTGGTTATTAAATGGAGTACATGTTGCAGA
TACTCTCATTGAGCAACGCATAGTTCTCAATTCTCATTTTTTTTTATATATCTGGGGTTAGGCGAGGATGTCTAGGTAAAATTAGATGATCACCCAAGCATATATCTGTATTACATTTGT
GAGTAACGGTTTGTACGATGGTAAGAATGTTCTAAATAATGGGCACAGTAAAACTAAATTTTGGTCAGAATGGGGTATGTTAGTGGTGCGTGCTTCTATTTGTATTTCTATAAGGCTACT
GCTTGTTCCCTCGGTTTTGGGTCTGTTCAGAACTTGGAATATTGATGAAGTTGTGATACTTGCTTGTAATTTTCCCCATTTTTTGGGGCTTTAGGGCTTGAATGAAGTAATCGGGGATAT
CTTTTTCATTTGGACAAGCTGCTATTGCTACTTTTTTGTTGTCCTTTTTAGGGGCATTTCATATCGTTTTAAAGTGCACTATAATTCTTAATCGCAGGGATATCTTAGAGCTTACTGAGG
CCATAAAAATTAAAGATGGGGAGGCAGAGGCTTATATATCAGAAATAGAGGTGCCTTATTTTGTGTTTGTTGGTCTGCTTATTGATTTTTCTCTGTTCATTCCAGCACATGGTTGCTTTC
TATTCCATATATCCGAAAGCTTTCTCCCACCCACCCCCATGGTTTGATTAAATTGCCTTCTTGTAGACTATTGGTCAAGCATACGAAGATATGCAGACACAGAATCAGCATTTATTACAG
CAGGTGACGGAGAGGGATGATCTTAATATTAAGGTGTGTCTTTTATTTCCTTACATATTCGAATGATTAACTTTACCATCTACTCTTATGGTTATTAATGCTGATAAATTTAGTTGATCC
TTGATTTATGCAGTTAGTTTCAGAAAGTGTAAAATCGAAGCAGGTTCAGAGCCTTTTACAATCTGAAAAGCAGGCCTTGGGAAAACAACTTCAACAAATTAATGCCTCCCTTGAATCTCT
CAAAACTAAGATTGCTCTTACGGAAGATCAGGTTAGATTTCTTTTCCCTTGCAAAGGATGACATTAACATGACAATTGCCTGCCTCTCAATCAGTATAAGGAAAGGACCTTTTCATTATT
CCACAGATGAAGGCCAGTCTGACTGATGTAATTAGATCTACCCGAGAAGAAAGACATCTTACCATTAGCCTTGAAATTGCAAAAGGGGATCTAGCTGACGCTGAGAAGGAATTGAAGTGG
CTCAAGACGGCAGTTGCTTCTTCTGAGAAGGAGTATGAGCAAACGCAGCAGCAGATAACTGATATTGAAGCAGAATTGGAGAGTGAAAGGTGTGTTTTAGGACTTTTTTTTGGTCTTAAT
TCACTAATTTTAGTTTATGTCAAACACCGTCTGCTATTATCCTTGAATTATATGTGAAAAGAAGTAATATTTCATCTTCTTTCTTTCCTCATTCAAAACATTTTTTGTGCACGTAATAGA
CTTGCAGCTGCATGCATTTGGGCTCTTGCAATTTTATATTTGTCCCTCTTTAGTTGTTCTGTGTGGGAACTGAATCAATTTGTTGATTTGTGGAGGCATATATATGTTACTTTTAGCTGC
GGAACCAAATAAATAAACCTCTACCCAGATCTTACACTACATAGGATTAAAGTACATCTTGTTTATTATATAGCTGCAGTGATTCAAACTTCCTCTGTCTAACTGAAAAATCATTGTCAA
CAGAAGTTCAAGGGAGAAACTCGAGGAAGAGTTGAAGGAATTGAATAGTAAGGTGGCCAAGTTGACTTCTGAAACTGGAGAGGCTGCTATAAAGAAATTGCAGGATGAAATTAATGCATG
CAAAACTATTCTCAAATGCAGTATTTGTAATGATCATCCAAAGGAGGTAAGATTTCGGTTATATCATTAAGAATACGACTGTCGTTTCCTGTATTTTATGATGGTTTACTTATATAACTA
TACTACTGATTTTGGCAGGTTGTAATTGTGAAGTGTTATCATCTGTTCTGCAGTTCATGTATTCAACAAAGAATTGAACGGCGGAATCGCAAGTGCCCTGCTTGTGGTACTGCATTTGGT
CAAAATGATGTTAGGGCTGTAAAGATATGAATTTGAACAAGTCCTTGGAATGTGATTAGAGAGCTTATTTTTGTTTTTCCCATTCTTGCGGCTACGTATTTATTTTGAATGCTATTTTGC
GCCTAAGAAATATAATGGAAAAGAAAGTTCACAGGAAATAGCATAACTGTTGAGAAAGTTTTAGAAATGGCTCGAAAATGGGTGTAATCGCAATGAATTTAATTGATAAATCAATACTCA
TGGACGACAATTACAAACGCAAATAGAAACGTAAAATTGTGACAACACATTTAGTGATTCATAACTTTGGCATGAATGCTGTCAAATTTCTTTGTTGGGATGTTTGCTGAAAAGGAAAAA
TTTAAACAAAATATTTGTTAGTATGGGATCACAAGTCATTGGTTAAACTATATAGAATATTTCTAAACTTCAGGTCGTTTGGTTATCACGGAGGGAGGGAAGTCTAATTGGAAGTTTAAT
CTCATTTCACTAAAAGATATTGTATTCTTGAACATGAAAATCAACATGATAGCTATTATATAAAAGTTGAAAGGCACAAATAATATCCCGCTATATATGTAGATATATATAAAGCTTCTC
TAGGATATTATTATTGGAACTGGAAGCTTTAAAGATGCCGAGGAAATTAGTATAAAGTGAGTATCATTCAACCAGCAAAGCATCAAATGACATCCATTCCAAGTAATTTTCATTTTGTAG
AACATGAACACAAAGTCAGATTTCAATATTGAAGTTCAAGAGATTTTCCATCACCCCTACCTACCTACACCATCACAGAATGATCATTTAGGGGCCTTAGAGGGAAATTTGAACGGTTTC
CCTCTCCGTTGTACAAGTGCAACACTTGACAAATTCAGAACTATTAACACCTGATGCAGCTCATCTTAGCGGATTGCTCCCTTGATGTTGAGGGCCAGATACGGATGTAGGCGAGAATGG
ATCATAAACTTGCTGTCCTCCGGAACTGGGTGGTAGCAGCTTACCAGAAACAAACGTCAGATTGCTACTGTACTGTGGGGGTGTAAAGCGGAGTTCAGGTTGACGTGGTCGCATGTGGAA
GTCTTGTTCAAATTGTATGGAGGTTCCTGGTCTGTGAGGAAAATTCCCTGGCAAGTTTGGCATTTGGAATCCTGGACCAAAGTTTCTTTGATGCAGTTGTGTTCGAGGACCTGGATTGAG
AAAAGCAGGAATTCTAGTTGAGACCTGAATGCCAATAGGATTAGAAGCTATATCTTGAATTTGATGAGTACCTATCTGGCTGCCAGCTTGGGGTCCGGGAAAGGGTTGATTGGCAACTCT
CAGAAAATTTGGGGCCGATGGATGGAAAGATGGTGCCCCGGATGCAGGCTGTTGCAATGTAGGTCCCGTTGGTGTGTTTTGAATGTTTAAATTCAAAATTGTTTGAGGAGATGGATTTTG
TGGGCCACGTGGTTGGAATGTAAAATTACTTGTATTGGTAGGTGGTGTTGGAGGGTTTGAAGCAGATCCACCAATGAAGTTACCAGGAGGATTATGTGCAGGTGAGGGTAACAGTGCTGA
AGGCACCGAAAATGGCGGGCGATGTCCCATCTGGTGAGACGGAATTGGAGCTGTATTATGGTGATTCACATTTATACCTGTTGCTTGGGGAGTGGAAGGTCCAGAAGGAAAAGATGCATA
TCCATCCACATTGGCTGCTGCTGTATCTGCAGGTGCTGCGCCAGAAATATTAAGACCCTGAGGTGGAGCTGCTCGAGGCCCAAACGGCGGGGGAAGTGATGGAGCCATCTGCCCCATGTT
ATTTGCACCCATAGATACTGAACTGCCAACTATGTTAGGTGCCAATGGGTGATCAGGCCGTGATCCTGGAGGAAAGCTACTGGGAACAAGTTGAGGCAAAGATGATCCTGCCATATTTGG
GAGTAGTCCTGAAGGTAATGGACCACTACTAGTGAAATTTGGTTTTGAGACATTAGATGGAACCAATGAGGGCAGGCGTTGATGTGGCAAAGCATGAAGCCTGGGTTGGCCAACATGACT
GGTTTGAGCCATGAAAGGTTGCTGTACGTCTTGTGCATGTAACTGTTGTCTAGGAGGAGGAACAGGAGGGCCTCGGAAAGCTGGATTGAAAGAAACTGGGGCGGGTGGATGCGCAAATAA
TGACGGTACATTAGGGACGTTTGAACTGGGTGTTGATAAATGGATTGGATTGTTTATAATTGATGACGGAGGATTTTGTGGGGAAATAAATCCAGGAGCTGGCGTTAAATTGTGAGAAGG
CCACGTACTAGGGTAATGAAACTGCCCTGGCACTGAAGGTGGCCCGTAAAATTGTCCTTGTTGCATAACCCCCTGGTTCGGCATAGGATTCTGCCCCATATCTGATACTGTAGTACCGTC
AGCTTGGCTGGAAGAACTTTCCTCCGTAGAAACCAAATCAGACAATGTGGAACCAGTGGCCAGATTTCCCTGTGAGAAGAGGTCGAGGAGTTACAGATAATGAGCATATATCATATCAAA
TTAGATGAAAACCACGGAAATTAGTTATTCTTCTTGAAGCAATTAACTAACCGAGATTGAGGTGATTAGGAGTTCTATAACAGAAATTGCAGCATCGATCTTATCAAATGTATCAGCTGA
CATGTAAACATACAGCTCTTCATAAGTATTCTGAATTCCGTGTACATCAGTTGGTTTAATTTCATCCTGTAAGAATGAAATTGGGGAGCACAAAGAGTTAAATTATAGGTAAATTAAAAG
CCATTAGGTGTCTTCAAACTTGTTGAGAAATTCTCAAATAGCAGACTTATCACTTATAAAAAAAAATAAACCATCATAGGTTGATCTAGTGAGAAGCCCTGAAGTGTTTTCAAACTTAGA
AAGAGATTCCCAAATAACATGTTCGCACTTAAGCCAAAATAAACCATCATAAGTTAATCAAGTGGAAATTTTGAATAAGTGAAAAAGTAAAAGAAACTTTTGAGTGGATTCTCGACAATC
ATATGTTTTTATTTTCAATATTGAAGTTACAGAACCCAAATATGAAAAAATATGAGGAAAAAAAAGATGTGAAACCAAAATAGAATGGGGCTCCAATCAAATTTGCCAGCAAAATGTTTT
TCAAGCAACGGCCTTCTTAAATTAGTCAAGGTATGTTTGTGAGGAAAAGACTCCAAATATACATATATATTTGATAAGAAATGGATATGTATAAGAAATACTATGTATCAAAGCTTCAAA
ATGTAAGAAATACTATATAATATTACTATTATTAAGGTAGCATTGCACTTGCAGGGGAAACGAGGGTTGATATTCTATTGCAGAGTTTAAAAATGTTTCCTTCTTGGTGACAAGTCATTT
CCCACGATGTCTAAAATTATGATCCTTTAGTTTACTTTGTAGTAAGAAGAAAGGACTAAAACAAGTTGACACGACAGACAATGCATAACCAGTATCAACCATATTTATGACTTTCTTGGT
CAAAGGGCTCACCTTTTCACCAGTCCCAGCTTTAACACCACAAATTCGTATTTTGGCTCCAGTTTCCTGACATGTTTGGTAAATGCATATATATTACAAGTTGATCAAAAGGAAAATAAT
ATTTAGTACATCTCTTAGCCTAAAATGATTTTCTTACCTTTTCTAATCGCTTTTGATTTTCACCACTGGGGCCATATATTAAGCCAATAAAGTTGAAACCAGGATATTCTTTAACCTACA
TGGTAGAGAAATAATCGCTTAAAATTAAAGACTACATAAACGGAAGGGAACTCAATGACAAGTTCATGAAAATAAACTTAATTTGGGAATCATAATGAAACGTCCTTAAAGATAGCTAAC
TACTAGGACTAGGACATGTTTTAAAATCCTTCAGGACCTCCTTAGGAGGTAGAAAAGTTAACTTTAACATTTAATAAGTTCACTAGATTCACACAATATAGATTCCATTTAGAAAATGTA
AGCATCTCCTAGCATGATTCCATTTTATAAAATCAAGTGAACGATCCTCAAGGAATTGGGACCACTATTGTAATTGTGGAAACAAGAATAACAGTGCTATAATTAGACATCCTTCCTGCT
ATTTTGTTGTAATTTTCCATTTCAATCAGCGAAAATTTTCTTTTTCCTTTGAAAAAAAGTAAATAAATATCCTTTCAAGCCTCATCCTATGTGCAAAAAAGGAAAGATGTGATGGACATA
GAACATATGATTAATTGGATATTGTGATTAAAATACAGGATGAAAGTATTTCTACTTCCCTTGAGGGACAGAGTGAATAAACAAAAGGTCACTGTGTTTCTAGTTTAGACGATGTTACTA
ACCACAGAAGAAAAGTAATGCAAGACCAATCTTACCGGGAGAGGTAACCTGTCCTCTTTCAACAATGGCCTATAATCAGGAGGGGCCTTATAACTTGGATTTAGTTTTAGTATTTCACCT
GTATCATCAAGAAAAATTCTAGTGAAAACGTTAAAAATTCAATTTGAGGTCATAATAAAAGCAATTCATTAGATAGGCATACCAATAACTTCACGTTTTTCAAGTTCCAAAAGTTCATTG
TACGACGTCTGTATATTAAAAAAAAGGCATACATCAAAATCATACAAAAATAATGACTGTTTTTATAATTCTTATTTTCTTAAAGTGAGCTCCGAATTTACCTTATTATTTGCTTGGGAT
CCAGGGGAATTATCCTCTACATTCTCACATTCTAATGTTGAATCTTGTGTCTTTGGAACCTCCAAGGCTCCAGACTTAAGAAGTTCCATGATTTGTTCCAATCGAGTCTGCTCAAAATAT
GTATAACCATAGAGGCAGTTATGTCACTAAGTAGCACCTGGAATGGGAATCTTCCATGCGAAACAGTCACACAGAAGACACTGACATTTTAGCACCAGATATGAAAATGGGAAATTCAAT
GGTAGGAAATTTAGAATATGTTTCATGAAACTGGGTCAAAGAAGGTTTTGAAAGAATAATGTCTATTTAAAAAGAAAAGTAATTAAAGGAAGCAGTATCTGTTCAGGGAGGGGTTTCTTT
TTTTTTTGGAACAAAAAACAGAGAGGAAGTTAAAAATCTTTTATTTTCTAATCCATATATGGTACAATACCAGCCATGTTTTTGGCATGTTTAATACTAAGTTAATGCTAAAGCAGTAAA
TGATGCATGGGATATTAATAGCGCAAATAGTCATTCTAAATATCAGAACTCAAAATGGTTAGAAGAGAAAAGGCCTACAATTGAGATATGAGCATTGAGCAATAATGATCCCAGATAAAA
CATAAAATAAACCAACCCCCACAGTAATAGAAAAGTATGGCACTTCAAAAGCTCCCAAATAAACAAGATGAACGGGGAAATAAAGGTGTTCCATTGATCGTGAGTTTTGCCTTTAACACG
TCATTGATACCAGAAAAGTGTGTGGGGTGGGAAAAAAGAAAGATAGAGCTCCATCAATACCTGATAAGCTATGAGCCGCCCCTTTCTAACTGCAGTATCTTGTGTTAAATCAGGACCCCA
CTTTGTATTCCTTTGGGTCTGTTTATCATTTTCTCCATTAGCTGATGATTCATTCCCTCCCAACTTTTTGTTCACCCGAAAGATTGGAACCAAAGACCCTGAAAGTTTGTTTTTTGGTAT
AACAAACCCAGTCTTTGCTGCAAACATGGAAACCTTTTGGCTTCCCACAGGTGCAGCAGAAGAAATAGTTGCTCCAGACATCTTCACATTTTTAGATTCAATATGAGATGTCTTTTCAAC
CTCTGCACTCATACTGTTCTCCAATCACCTTAACAACCTATGATATAGCATAAATGAGAAATGAATGAGTACATAAAGAATATAACCTTGAAATTTTCATTTACACAGTTACACTATGTC
AGTGTGTAAAGTATTCCTAAACAATAGATCAGCAAAAACTCCCAGACATTTCCAGCATGTAATGAAAACTTTGCTAAAGCAAGTGCCTATTTATTAGTCGAAACATAAATTTCCACTGCA
AGAAAACACAACTATGCTTCAATTAACAGTGAACAACCTTTTTTTTCTCCTAATATCATAATGACATTTGACACATTCTCTACAACGCCGTAGTTTCTGGTCTTGATTCATGAAATTAGG
AGATTTTATACTAACAAGAAAACAAATCCACCCCCAAAATGTCAAAATCTTACCACCTGGTCCAAAAGACAAGTAAAATAATAAAAAAAAATTGAAATTGCTTCAAATTTCGTCGCTTCC
GTGGGGAATTACATAGCGTAATAAGAAACGATCATGCAAAATACAACGTTTTTGTTTATCCTTCAGTTGCACAGGGGCAAAAGGGGGTTAAGAATTTGACGATTAGCATCCATTTTGTGT
TCTTTTTCCCTACACCCAAATCATCTCAACAACAAAAGGAAAACAAGTAGAAATAGAGAAGAAAATACCTGGACCGATATGTTCTTCAGAATTGAACGCACAATGAAGAATTGGTGCGAA
TAAACAAAGCCACTGCTCTGGGGAATGGCTTCAGACAGAAGAAGGTTTCTCCCGCCGGTGTCCGGTGACGCGGTAACCTTTGTGTTTCATCTCGTTGGGCCGACCAGGTAAATATCCAAC
GTTCGTAGGCCTCAGCTTGTTAATGTGGACAGTTTTCGGCCCAAGTAATATTTGGGCCCAACAGCCACATTCTTTTTCATTTTTCAAGNNNNNNNNNNNNNNNNNNNNNCTACAACATTT
AACAATTTATTTGTTATAGGCATTTTGATGACTCCTCGGAAAAGTAATTTTTTTGATGTGCTCTGATTAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGTTGGGTTGGGTTGTTGGGTGATATTTGTTTTT
TTTTTTCGTTTTAAAATTCTAGTGGTTGTAAAGTTCTAAATTCGGATGGTCGTCGAAGGCTAAGGAGACTGAGATCTGATGGACAGCGAGAAGAGGGAGGAGACAACGAAGAGTCGGACG
AATGGTGAAGAAGACAAACTGAAATCTGATATCTAAGATAGAGATATAGCGCGAGGTGGAGAATTGAGAAGAGACAAAGCGAGGTGGAGAATTGAGAAGAGACAAAAGCGCGAATGGAAA
ACACAGCTACCTCTTCACTTCTTAACTTAACGAGACCCAAAACTCAAGCTACAAATTTTCAAAATTTTCAACCCAACACATATAAATATGGATTAGATAGTCTGAATTGTGAGGTACCCA
TAATTTAAATTTAACTTCCAACTGAATCTATCGATAATAAACCATGTGACTAATTACACGCTATCACTCATTATACTCGTAAATCTTTTTTAAAAATGTTGCTACAAATCCATTTTTAAT
CCTAAAATTGTTAACTATTACATGTAATTATGTTAACCTAAGGTAATGGATGTGTGAGTTTTATAACATTTAGTGCTTTTTTTTCATCAATTAATGACAAGTCAGATATATTGTTTATTG
AACTATTTATTTGGATATTATAACTTATCCCTTGCAAAAATCAAAACAAATTATTGGAAACAATGAGATTATTATTTTATATATGATACACCATTAATGGTTTGAACAACTATAATAAAT
AATTGGGGAAATAATGTCTGTCATAATAACTCATAAATATATGTAAAAGTACAGAGTGAAACAAAATTCAATTTTATATAGTTTATACCATAAATGCCCTTCTTACCTCACAAATTAAAT
AATGTTCAGTCCCTTTCTTTCCCTTCAAATATCAAATGCACATTTTTCAATACCAAAAATTACTAGCAGTGTGTTGGTTAGAAACATCACTTTTTCAACTTTGGTGTAAATGTGACAATG
CCGTTTATCTATAGGTCCAAACAAATTTATTCTGCCTCTTTCAAGAAAATTAAAAGATTAGTAATGATCAAAATATCGGTGCACGAAACTTGTTCGATATGGTTGACCTCAACCACGATT
TTATTTCAGTTTCTGCAAAATATTATCGCATCAATATAGTGTTGTACGTAGAGTAGAGTACTTCCTACCTTAAGTTACTAACCATTTTAAGAGATGTACAAATGGACTCGCTCTTGTTTG
GAGAGCTTTACTATCTTGAGTACGGTAGTGGAATGAGACTATTTATAAGTCAATCTATCATATCTTAACATTTGTGTGTGACGAAAGGTGGTATTAGGGACGTTTTTTTTTTTCTTCTTA
ATTTACACTCTAGCTAGGTTTAGAGTGGTAGTTCAACCTCGACTTATTTTATATTTTTCGATTAGTATATTGATTGGACGAACGATACTTTTGTCTTTCGGCGTAAACTTCTCTATAATT
TTTTCTTAGTTTTTGGATTTAGACATGCCCTGTAGAGTCGTGGACTCTAGGGTCCACCCTTAATAGTGATAAGCATTGATGATCATCAACAAACATAAAATATGAGTTCTTAATAAATCT
GATTTTTACTCGTGTATTTGATGTTTACAAAATTCCTTTTTAAACTCTTACCTAATCACCTCCACTAGATTTTTCATTTTATAAGAGATTATCCATCAAATAAATAAATAAGAGAGATTC
CCTCATTTTATTTCTACTAAAATGCTCGAGTAAATCATATATCATACACTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAGATTTACTCATCATAATCGATTCTGTAGCGAATTG
ATAAAAAATCCAACATAACTCCAACTTATGAATGACTCCTCCTACCACCTCATATACTATTTCTTGACTAATTGAGTACAAAACACACAAATTAATAATTAGTATATTAGCATTGCGTTT
AAGAAACATAGAACATTTATAAGTGAGTATATTTATATTAGTTTCATCTTTTTAGCTTATATATATAAATAAATTCAACACAATATATAGAAACACAACTCCAAGGTTCACATCCCATCA
AATTCTCTAATAGATAGAGTAGTAAACCAAAATAAAAAAGTGTACGCAATAACACATAGACTAACCAAGATTTCTACTCACAAATGTGGTTTGTCTAAAGAGTTTGATAGCTTCATATTT
TTAATGCCTCAACGGCGATGTTCGAAATACGTACACTTACATATAGTATAGTTTCTATAATGTCGTTAATCATTTCAATATGCAACAGAAAGAATCAAAAGCTATACACATCAAACATAT
CGACAAACCATGTAATTTACCCTAATTAACTAGCTAGCTTCTACATATATAGATTTAAGAGTCATATCATGATTCAAAACTATATTAAAACAAATTGGTACAAACACTCGGACGAATACA
AAGATTTGACACTTTTGAGAAAACCCTTTTCAATGGCATAACATAACTCATTAGGACTTACGGTGTGCCATGTGATATCGTTGGAGCTTAAGTATACAAATCTTTCTAGGTTTAGATTTG
TCCACATCATCGTCAATACATATTCGAATAAATCGGGACCCACTACAACGTTTTGTGTGAAGTACTGTTGGGTCTTTCAATTAAAAATAAATGAATATGGTTGTAAAGTGTATTGAATGA
TATATCTTCTTCTTCGTTTATAGAAAGTTTTAATGGTTCATCCTTCTTGGTTTGGGATCTGCACATTTCTTTTCTGTTAGCTTTTTCCAATTATCTAAACCAAACATTGTACTAAAAAGT
AATAAATAAAAGTGATTTTAGATTATTATTGGTTATAATTATCAACCCCATGCTCCTACGTTGCTATTAATACATCCCTATACTTTTAAAATTAAACAACTTTTGACAACTTTTTCATGG
AACTCTAAGTTATGTGTGTCTATACACAGAACCCTAAATTTATAGAGTTAGCAAAAATAATATATATGAAGAAAAAAAAGAGAGAAAAATTAGGTTTCATACTTCGTGTATAAGAATTGA
TTTCTGAAAACACGTTGAAATGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGTTACCAAATAAGCCGAGGTCTTAGTGATTCGAATAATTTTCAATAAAATGTACGT
TCTCTTGTTCGTAGTTTTCTCTTAGTTTGAAGTTTTTCTATTGTTTTCTTTTAACTCCTCCATGTTTTATTTTTATATTGAAGTTGAAAAGAGGAAGACAATAAGAAATATGGTTCATAC
GTGCCCACATGTATTTATTTTTCTTTCCATGAATATATGCATTTAGATTTGTTCAAAGTAAGTAGATACAAAATTTCTATCGATCTATCAATGAATGTATACATATTAAAGGCAAACACC
AATCGAAGTTGGCTTTGGAACAAACTTCAACGTATAAAATGTATAACAATTCAAAACTAAATTGAAACCAACTACATGGTTGGATAATTTAACCTAAAATCAATCAACAACAAAGATTGT
TTTTCTTTCTAACACCTAATTGCATCGTAACTTTTTAATCATAATTTTCATAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTGAAATGGTTAACAAACTAGTAGTAATAATTTAAATTTAGAATGAATTATGTTGGTAGATGGCAACCAAACCAA
CAATAATATAATAGTAAGATAGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATATTGAATAGACTAACATTGTGATAATTGAATTAATTAGGTATCAAATTA
AAATAGACCAAAATTGAACCATGCCAATAGTAAGTTTACCTAATTTGATTGCAACACCACCTTTTTGGTTAGTTGAAAAGTTGCAAGTTTTTAATTTTGTAACATTATTATTATTTACAT
ATATCATAAGTCTCTTACACACATTTATACATATGTGGGTATGTGTGTGTGTGTATATATATATTTATTTGGCTGCCTAATTAACCTATTTCCTTTCCCCATCCATCTCCTCACTTATCT
CTATGCTTTAACAAACCATCCCTATTGTGTCCTACACACTTGTCCATATGTCCTATGCTTTTCATTTCTTTAGCCTTTACTGCTATAGTTTGTATGGACCTCCATGTGCCATTCAAACCT
AACAATTAGGGTTATGAAATTTAATTCATAACGCCAAAGTATAGTCAACATCCAAATAATAAATGTACCCTATACTTTATATGGTTTTTATCTTTTAATTTTGTACTTTTTGTTCTAACT
TTTAAAACTTGCATTAACATATATACTATAATTTGAATTTGTATGTATTGTTAATGTATGAATGAAAGTCAATTATCACCATCCGTTAATCACCTTTTTTTTCCTTCTACTTCGATTAGT
ATTGGTCGTACAAACGTACTTTCTCATTTCTCGAATTTTTTTCTCGTCTTTCTTTTATCTCTTTTTATAATTACAACTTTATATAAAACGAAAAAACTATCTCAAACGTAAATATAAGAA
ACTTTTTCAACATTTGAGTAGTCGTTTAAAAATATAGAGTGTTCATCTTTTCTGTAACAACGAAACAAAACCTGAGAAATCAAATATTTGAAGTACAGTACAAATTAAAGTTTGAAATCA
AAATCGTCTCACTGCATAAAACTAAACAAATGAAATACAAAAAAGGGTTGAAAAACCAATATCATATTCTTCTATATTCTTGTATGATGATTGTGAAAAACCATCGGCAGTTGGGGTCAC
AACAAATGAACTATTTTGAACTCCAAAATGATTTTGGATCAACATATCACTACACAAATGTGGATTATTAGTGCATGCTTTTTTATATTTCTTTTTCTTACAACCAATTGCCCCTACAAA
ATTAGGACTTAATTTCTCGTGCATGAACATGTCTCTATTCTCTATTTCTTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCATACTCAACTACTTGCATACACATTATACAACCT
TATTAGAACATTTAAAACATTTAAATCACTAAAATCTTATTAAACATATATGATGGTTATACCCCATAATTAATTAACCTTTCTTCTTGCTATATCTTTTTTCTTAATTTGTTTAAGAGT
GTTCTAAGGGTTTCAACTTTTTGAATAGGTATACATATATGCTTCATAAACCATATTATAAGAAATAAAATTGTGACATTTTTAAAAATAGTAAAATTCACTAAACTCTCCTTAGTCCAT
TTGAGTTTTTTTTTTTTTTTCTATGATGGGTTACTTGGGCAACATGATCTATCAGTATCATAATTTCTAATTAAGCAACTTTCTTGAAGGAAGTTGATATTACACAAAGGGATAAGGATA
ATCAATAATAGCTAAAAAAGAGAAAAGGGAAAGTGCTAGACGAGTGGCTATATATCATTAACTCCTAAACCAATCACCACATCCAACAACTTTCTTTAATTTTCCCATCCGCCATACGGC
ATGGCACCATAAAACCCCACTTTCCCCCCCGCTCATTCCGCCCCCCATTTCCCAATACTCCACACACCTCTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCGTTTCAATGGCTCC
CTCATCAGCTCATTTCTTGTTTGCTGCCTTGGCTCTCCTTTCTGTGGGGTTCGTGAGCTCCAACATAGACCAAGACAGGGCGGAGTGTGCGGACCAGGTGGTTGGCCTCGCTACTTGCTT
GCCATATGTGGGCGGTGAGGCTAAGGCACCCACCCCTGACTGCTGTAGTGGGCTTAAGCTTGTGCTTGATAAGAGTAGGAAATGTCTTTGTGTGTTGATTAAGGACCGTGATGACCCTAG
CCTTGGACTCAAAGTTAACCTTTCCCTTGCCCTTGGTCTTCCTTCTGCTTGTCACGCCCCTGCCAACATCAAAGATTGCGTCGGTATGCTTTCTTCCTTTTTAGATGATATATATTTAAA
TTTAGTTAAACTTTTGGATCAATAGATTGTTTAAGACCGTATCACATTATTATCTTGTAATGTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNCTTTGATTATTGGTAATGAAAAAAATACTTAATATTCAACTTGAGGTTTATCTTTCCTTGTGGATCTTCTTATTTGTTATGTAATTAGTTCTTCTTAGTTTGTGTTGG
ACTTCATCTATTTTTGTGCAATTCACTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTCCTATGTATAGATGATGCGTCTAATCACTTTTCTTTTAATTCTTAT
CGTTTCTGCAAGATGAGATATGGTATAGAAATTAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNTATTTATTGTACCTAAGTATTTTCCCTCAATTAGTTGTTTATACTACACGAGCTATACTAATAAAGAAAAATTGAAATACTGATTTTTCTATTTATTGT
ACATCATGTCGTGTTTCTAAAAATAAGATGAGACTCACGAATATTAATATAAGAAGTTCATTAATAGCGTGTCGATAAGAAATATATGATACTCTTGATACTAAAAAATTTCTAAAAAGG
ACGATACACTTAAGTATGGGTCTTTTCATACTTAATTATCGCTATTATTATTTTGTAATGGAGCATGTATATTATTCGTGTGAATATAGGGCTTCTCCATCTCTCGCCAAACTCCCCAGA
GGCTAAGGATTTTTTGGGTTCGCCCAACTCCAAGGAAACTAACACTTCTACGCCAGCACATGCTACTCCGGGTATTAGCTCAAAACCCTTCTTCTTTTCAAAAAAAATTATTTAAATTTC
TCAACTGCCAAAAACAAATTAATTTCGGACCCGTTTGAATTTACTTGAGAAAACTTGATTTTTCTAAACACTTTTAACAAAAATTGTTTAATAAGTGCACTTTAAAAGATCTCTAAAATA
TCTTAATACTTACATTCAACACTTGAAAATGTATTCCAATATCACTAAATTAAGATGGGTGATATGTTGTTTTAATAAATGAATACCTTGGCTACAAGTGCATGCATCATGTTCGTGTTG
AGGATCGATACTACACTATAATATTTATAATATAGATGAGTTACACCGTTCTCGAATAAAAAAAGAAGATTAACTATGGATTACAACTTAGAAGTGAAGTAAATGTAATTTTTTGTTTGT
GTTAAATTGTTGCAGTTAGTGGGAGTTCTTCACAAAACTCAGAAGTGAAGAATGATGGAACGAAGAGGAATCAGTGGTTGGGTGTGGAGATGTTCATTTGGTTCATTACTTCATCGTTTC
TATTCACTTGCATTTGGTAAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTCCATTAGNNNNNNNNNNNNNNNNNNNNNCATATATGTTTGCTTAGCTATAATTAAT
TTTATGATAATTATCTTGAGTGAGATCATGATATAAACTCTTTCAAATTTGTTTCATAACCATTACTTTTAAATGTAGTTTCTAATATTTAATTTCATTGATTACATGTTACCTTTGGAT
GAAGTAATTGTCCTTTTTTTTGTTGAAAGGTTTGAGGACACATTTAGAAAGTGATTGACACAAAAAAAAAAAAAAGTTGTGTTGGTTGGTTGGCAGCTAATTTGATTAAATGTTGCAATA
CAAACTTAAATACGTGATGAAATGATCAAATACAGATGTCAAAGCAAACCTAGTTCAATAGCAATTAACACGACCTCCTATATGAAATTCGTATAGTTATAATCAATGTTTATTTTTTAA
CGACAAAACTAGACATATTTTAATCATTAATAAACATTATAACAAAGGATAAACAACTTGTGAAAATGGCTACATCATGATGCTAATGATTAATTGTGTATAATCGATCTTTAAAACGTT
TCATTAATTAGTATGTTCAAATTTGGCATGCATACTTTTGGGAAAAAAATTAGTCTTCCATATGCTAACTTATTAAGCATTTTGTTATTTATAACATTTTTATTATGAATTTTGAAAATA
TATCCGGTTCGTTGCTTGAAAATTATTGTTATTATTATTTAATCAGTTTTCGTCTTAGACAAAACTTAAAAAAATAATTGAAAGTAGGGAGACCAAAAATTAAACAGAGTATAGAATTAA
AAATTGAAGGAACTTTAAGGTGTGACACTAGAAATAGTAATTTTTAATCTAATTTAAGTTAGACAATGTATTTGCATCAAGTTCATTGTGAATAGAGTTTGTTAAGAACAAGAGTATGAA
AATAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAAACTTTGTAGAATTTATATAACAGAATCCAAAAACAACTTTTCTAAACAAAAGTTTGAAGATTACACCAAATCTAAAACAT
AAAACAGAATGTAAATGATGTATCAAAGTCGTCTCCAGCGAAAGCTAAATTTTTGGGAAGATCCATAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAATGTTAGGGGT
AAAGAGAGATTTTTTTGGGTTTCAAACGGGAAACGCGACCAATGAACTACAGCGGAGAAGGGGAAGGTGAGAAAGATAAGGGTGATTTACATTTGTCAAATCTTCTTCAACGACAAATCA
ACAATCAAAACTAACCATTTCCAAATCTAACCCTCCAAATTTCCATCACCCATCACCGCCATTTCTCATTTTTCTGTTCCTTTTCCTCAATCAATTGCTTCACCAACTGAAAGTGCTCAT
TTTTTGAGAAAGAACCATCAACCTTCCAAATCCCAGTTTCCATCCATGGCGGGATCTCATCTGGGTCTAATCTTTTTCACCTTCTTCGTCTTCTTGACCTCTATTCCTTCGCTTTCTGCA
GCAGGATCTGATGCTCCCACTGTCTATGATGTTCTCCCCAAATATGGCCTTCCCAGTGGCCTTTTACCTGACTCCGTCCTCGACTACACTCTCTCCTCTGATGGTCAATTTGTCGTTCAT
TTGGCCAAACCTTGTTACATCCATTTCGATTACTTGGTTTATTACCATAAAACCATTACTGGGAAGCTCGAATATGGGTCCATCACTGATCTCGACGGTATCGAGGTTCAGAAGTTGTTT
CTCTGGTTCGATGTGAAGGAAATCAGAGTTGATTTGCCGCCTTCTGATAATATCTACTTCCAAGTTGGGTTTATCAACAAGAAGCTCGACATCGATCAATTTAAGACTATCCACTCATGT
CAGGATAATGCTTTGGCCACTTCTCTTGGCTCCTGGAAACGGATTCTTGAGGTATATTCTCAGCCGCCCCTCCAGCTTCTGATTGTTATTTGCATCTCTTTTTCTTTATCCGTTTTGTGT
TCTTTAGAATCTTACATGGGTCTGTTATCTTTACTGATTATCATAAACTCATGGGTATGTGTTGCCTGCTGTTGATCGCTATGTTTTGTTCGTGCTTCGAATTTTATGATTCGATATTGC
TATTCTATTGGACGATAATTTGTTCAAGAAGTGTGATAGATTATGTGATGTTTGAAGAAATCTTGTATTGAAAACATGATGGCATGTATGAACTCAAATGTAAGTAGGAAGCAGTTCAAG
ATAATTTAGACTTTGACCGCTATTTTTTCGTTAACTTTGTTTTGTAAAATTTATCTTTCACACACTTGTGGAATATTTCTTTTGACGTGTTGATTTTTGGTGAGGGAATCATCCTTTGTC
ATGAAGGTATCATCATGTTAGGCAGCCTTTGTCTTCAAGTTATCATTATGCAGGAGGAGTATAGAGTTTTTAAAAGAAGGTTCAACCTAATTCATACACGTGGTTTGTAAATCTATCCTG
TAATGAAAAATTCATGAAGTGTCATTCCGAGTATAATTCTCCGGATAAAGTATCAATTACTATCTTAAACGTTCTTGGTTCAATTCTCACTTAGAAAATGAAAGTGTTTGTGAATGCACA
GAATCTTTCATGGTAGAACTTTTGTTTTCCTCTTTTAAGTAGGGACGAAAGTATTTATTAACCAAAAGAGAACGGACATAAAAGAGGAGTCGGGATATCACCCAGATGACCAAGGGAACC
AAACCATTTGGATTGTCCATCTCATTTGCATTCCTGTGCTAAACCTCTGAACAACAATTAGGACAATAGGGATCCTCGTCCCTCATTTTCCTCGGTTCTCAAATGTTCCGAGATGCCAAT
TCAACGTTTTAAACATTTAATTAATGTTTTCTTCTCTTCATATGAAGAAAGTGAAGAATGAAAATTGAAACCGATTCATCTGGGTTCTATCAAGGTTGTTTCAATTAAGTTTTGGTGTCA
GTGGTCATTTCATACAAACAGCTTAATGATCTATTCGTTCGTTTATATTATTTGAACTTTTATTCTACATCTTTGTTGAGTTTGGATTATATTTAATAGTTATTGCCTTATTGGGCCTGC
GGTTGTTTCATGTCACAGCTTTAGTGAACAGATGACCAGATTAAGCTATACTGCCTTCATTTTTTCACCTTTATTCTGTTAATTAATGCTTTAATACATCAATTAGAAGTTACTAAGAGT
TGAAGCTGAGTTGATTTACCTTCATGAGCACATATGCTACTGTTTTGAATTCTGCTACTGTAGTCCTCCAATGAACACAGTTATTCTGGCTGCTTGATATTCGAATATGATTGTTGTTTT
GGCCTCTCTGTTTGTCACTTATTTCTTAGCTTCTCGAACATGTTGCTGTTAATTTGTATTGGTCTTTGGGATTAGCTACTTATTCGAGGGAATATTATGCAAGATGTGCTCTATTACAGT
GTAATTTTAGATGACAGACCAATATGCTAACCTCATTTGTTGAGTATGAGTTAAAAGAATACACTACAGAGATTGAATATGTTTTTGGAGAGCAGTTGTATCATGCTAACACTTTTTCAT
TGGTACTCACAGCTCCCGCCGCCGATAGGTGACATCCAGATGCTAATCACCGAGTAGCTCGTCTTCACATGTCCAAGTTCTTGAAGTTCTTCTTGCTGCATTATCGAAATGAGCAGAAGA
AGAAATTTAGGAGTTTTTAGGTATATGGTCTCAGTTTAGACACCAAAATGCCAAACGTCTATCTTGGAAGACCTATGATATGATTGTTAATATTTGATGTGTCTTTCAGTTTCATCCTCA
AAAAGAAATGCCCAAAACATTGGCATTTGAGGTTTCTTATAAACTCAATGCATATGAATGAAACGGTATATTAAATAGTATGAGTTTGTCATCTTTTATTCGATTAAAGATTGCCAAAGT
AATTTTGAAATTCAACGATTCAAAATGAGGATAAAAGAATCTCTTGAGTAATTAAAATGTTCAATGATTCAAAACAAGATAAAGATTCTGGTAACAAGTCAAAAATATTTTAAAATTATC
TTTTATGTTTCTTAGATTCCCTCACTCTGTTGTCTTGAAGAAGCTGATGGGGTTTGGTTGGGTTATGTGTTCTATGTTTTTGAAGAATGAGATCTCATTCAAACTTCAATGGAATGAGTT
CTGTGGGATTTTTACCGTTCACACCTCAAATCATAAGACTAAAAGAAACCATTAAAATAATAAACCAGAAAGTAAACCGTGTCCTTCCATTGATTTCGAAACAAAATCACTTTTTAACAT
GTTTAAGATCATTTTGAAATACTGAATAAACTTAAGTTTGAGCAGTGAGCAAAGTAAATTTTTGTATCACAACCAATTGAACGTTAGTTGAACTTAAAGTTGGCTTATTTTCATCATGTA
TATATTAAGAGATGTTAGAAATATGAGAATATAAAGTTAGCAACAAAATTAATAACCAAAAGTAAGTAAATTTCAATCTCAACGAGTTATCAATTAGCAACAGGTTTAAGCTTAACAAAT
TTAAATTACTATTCGAAGATGATATGGGGAAAAGAGAGACCAGCCAATAGAGAGAAGAAGAGTCAACTTTGTTGTTATACCGAACGAATAACTAAAGTATTAATCAATTAGGAGCACGAG
TTTCATGTTCAGCAGTAATACAATGATATAATGATAAGTTAATAATAACAACAATAATCATAAAAAATAAAAAAGGTTAAATAATTCGTCGAATCCCTCGTGGGAAAGTCAAATATCTCA
TTGAAATGCACCAAATCATATTCATATGCTTTTCCATTCAGTAAGTTTACAATATAATAATCCAAATAAGATCAATGTTGGCGTTAGTTTTCAGCTTCATTTTATACTCTTCCTCACCTA
CTTGCTTATAAAAACACAAAACTCCATTGGCAACTCAGCCCCCACATTCAAACTCCACTGATATCATTTCTAATTCTTTCATAATACCAAATCCCATTACTGCAATGGAAAGCTGCAGAG
ACATTTTCATTCAAGTCCAAAGCAAGAACAAGAAGGACAAAGATTCTCCAATAATGAAGCAAACGAAAGGGAAAGAAGACATAAATGAAAGAGCTGAAGCTTTTATCAGCAACTTTCGCA
ATCAGCTAAAGAGTCACTGAACCAATCATTCATCTCTATGGGAGAATTAGTTCTTTTAATAAGTTCTTGTAGTTCCTTTAATATTGATCATTTATATTCTAGCACATGATAAGTGCTTAA
TTTTTATTTTTGGGTCTTTGACTGTGATTTCATTTAAACCATAGTGACTGTAAGATCTTCATCAAGTAAACCAGAAACCAATTTGTCAATGATTACAATTAATCGTGAGCAGCCATAAAT
CTTGTGTTGTTTATATTCTAATGAAATGTTTATATTCACAAGGCATCTCCAAGGATTACATAGTACTACTAGCATAAGATCCCCAACAAAATAAACAAACTAGCCTGAGATTGATTAAAA
AGATTTACTTACAAGTATTTGCCTTCTGTTCAAGAATGTAATGAAATTATCTGGGAACTTCATTCCAAAAGCAAATTCTAGAACTAAGCCCTCCTCCTGTAATTAAATCAACAGCTTCAC
CATTAGGCAATCTGAAGGCAACTGAAGAGGTCAGAACTTGATTGAACCAAATCCATGTTCTCTCCTTTAGCTCTCCGAAATAATAGTTTCTCTCTGCCTTCCACTTTCACCGTGCCGTTG
AAAAAAAAATTGACCCACCTTCGGCTTCTTATGCCTGGAGCACCTGACAATGCACAATATGACTCTTCAACCCGTTTCTGCCAGCTATACTGGACAATAAATTTGTAACTAGAGTCCTCA
AGTGACCTCTCCCAGCAATATTTTCCCACAGATGAGGATTGCTCTCAACCCTTTTATCGGGACTTGAAACGTCAACTAGGCTGATACTCATGTTGTTCCGGATAATGCAAAGCTTTCCAT
TAAGCGAAACTAGGGCAGCAGCCTCTAGAGCACGAGAGCTTCCAAAATGGAGCTTGCTATCGATGAATCTGTTCCATGAATCTGTTGCACTATCATAAACCCTAAGCTTACATCCATCTT
GGCAATCCAAGGCATAAAGTTGTCCGTTCAAAGAGATACTCGGATTGCGCCAGCCAGAAACCATGCCATCACTTACTGTTGTCCAAGTATTAGTTTCGGGAGAATAGGCTTCGCTCATGA
CCTCTCTGCGAGTTCCAAGTCCTTTCAGGAACCACAACCCATCATGAACTACACCGATGAATGGCACCATAGCTGAGCTCATATCTGAAATAAAGCTCCATCTGTTCTTGTTGGGATCAT
AAACCTCAGCTGAACGAAGAGTTCTCTGGATTCCCTCACATTCACCACCAGCAACGTAAAGGCAGTTATTTATAACACAAGAGCCAAAACAGTGACGTTTCCGAAGCATATCAGGTGCTC
TATGCCATTTGTTTGTACGAGCACTATAGAAAATCACCCGCCTCATTGATCCCTTTATTGGATCTTTCCCACCAAATAAGTAGAGGTGGCAACCACTGAGAACAGCACAGCCAAAACCAA
GGGCCTCCGAGTATTCAACAGGAACAGGTGGAAGTGATTGCCAAAGCTGGTAGGTGGGATCAAAGGCATGCCACGAGATCCTTCGATCACGTTCTCTTTTGATGACATAGACCCACTCTT
CTGCCATGCCAAGACTTTTCCTTAGAGAATAATAGAAGTTTCCCATCAGAAGTCGATACCATCTCTTGCAAACAAGGCGGAGTTTCCTGTGTTCCACTCGAGGGACTCGAATTAGACAAG
CAATGGCAAGATCATCAGGAAGGCCAGGGAGGAGTGGAGGTTGGACTCGGGTCCTTTCTCTCCGCGAAGCTTTACTTCTATGTGCATTTGGATTAATATCAGGCTGGATACATATTTTTG
AGCCAGGGACAAATTTTCTAGCTCCAACAACTGTTTTCAAGCCTGAATCTACTTTGCAATAGCACGACACAGAATCAACCTACAAAATATTATCAGTTAGATGCAAAAGAAATTATGCGA
CAACTTGCCAGAAAGGAAGAAAGAAGACAAAGGTAACCCCCTATGAAAACTAGTTGATCATGTACATTCAACTCAATCTTAAACTTTTGACACTATATTCGGATAAATGGTCTTATTTCT
CCAAGTGTTCTAGAAAGAACAACACTTCATCAGGAGATTACACCCAAAGCTACAATAGAAGTAAAGAGCATAGATCCTATGGTAGAGTGCAACTGGAATTCTGTACCAACCACGCCACAA
GGAAGACCGAAACAAACTAATGAGTTAAAAGATTGAAGCGCATCTCAAAATTTCCTTCAAGGTATGAATACTTTTGTAAATATCAATGGAGGGCCATGAAAAGTCTCGCTCAATATACAC
CTACTGGCGGTAATATTGCATTTATCTTACAAAGTTCATCTTGAAGATTTTTTAATTAAATCTATTCACCAATAAATAGATCTCCTTATAATTCACATGAATCTCACACTCATACTTCAC
AATCCTTCACAAGTTCCTCACATGTTCAGATTCAAAAGAAGTAATACAATGAAAGGCATCAAAACTTGCCATTACCCTTCATCACAAAGAAAGTACCATCCGCATAAAAACTACTGTTTC
TTCAATTGAATAGCAAATGAATAACACCAGAAAGAATTTGATCGAAAACAAATCCAAAATCCCCAAAACAAAGCATCTTTGCTAACATACTCAGAATCAATTCTCAGAGAATATTAAAAA
CGTGATCCAGCATTCAACAGAATACATAAAAGTAAAGCTCAGAAGATAATTTAGAATATTCAACAGAATCCTATCGGAAGAAGACATCAAGTAAAAAGATGCGCTCGTAAAATGCAAAAT
CCTCCTCAACTTGCTCAGAATCGAGGAACTTAACAAAAACCTACCGCAGGAAACCCCAATAATTGAATTCAGGCGCGAGAATCATACCGAGCCCACCAAACCTTAAAATCCTTCTCAAAT
TACAATGTTTCACCAGAAATTCACGAAGTGAGAATCGTAAACAAGAAATGCGAGGAGTTGGGAGTCAAGAAAAACCCAGAATAGCGCTCTTAAGCGAAAATACCCAGAATAAAATTGCAT
AATTTCCACGGATAACTTACTCGGCTACTCTATGGATAGCAATGGTGGTAACTAAACAAAAAAAATGACACAAACAGAGAATATTTCAATTCGACTAACCAGTGGAGCTTGAATTCGAAT
TCCCCTTTGAGCTCTTGAAGAGGGTTCAACCGATTCGTTCATTTCGGAAGCAAAGAACCATATAGTCAATTTCCAGCAACACCCAGAGTCCAAATCAAGGTTAAAGAAAGAGAAACAGAG
TCGGATCACGGGTTGGTTGAGCTCAAAACTTTCAACCCTTCAAAAATCTGATCTAACAGAGAAAACTGAACCCAATACGCTCAGCTTTTGACCCCAAAAGCCGCTTAAAAATCAACCAAA
TATGAACAAGAAAGACCCACAAAAACGTGAGAGAAAGAAAAGCCTGTGTGTTTGAACCCGAAATGAATACAAAGCCTATAGCTGGGTGGGAAGCAGTAGTAATCTACGCCTAATTACTGA
TATTTTCAACCGGATTTTAACCCATTTTTCTTTGAATAAGGCTGTCCTAATTAAGATCATAAAGTTTCAATTTTTAATCAAAGTTTTTTCAAGTCTGACAAAAGGACAAGAAACTTCTAA
TGACAAGGGTCCTCTTTGTTGTTACCATTAATGGGTCAAAACCCAATTTTTAGGGGAAAGAAGAGAAAGACAAGTCAATGTCATTCAATTCAATTCAATCCTCTCTTTCTTCTTTATTTT
TCTCTCCAGCTTTTCTCTTTTCCTTTATAATACAAACTATATGCATTATGCAATAACCAAATACACACAAACATGGATTCACTCATCACATTCCCCATTTGTTCAACAAAAAAATTATAT
TTTTCTATAAAGAAAGTGACTTTAAACCATTAAACACAAGACAATAATAATAGCCTTATTAACAAATATCATCACTATAATGATTGAGTTTTCTTTGTGCATTTGCTGATGCTATGATGT
GGGTTTGTATATGATTCTCAGTTTCAATACAGCATCTTTTCTTTTTCTCTCTTAGCTTTATGGAATATTTCTTCAAAATCGATGTATGTATGTAGAGAGAAAGAAAAAAGGTCTTCACAA
GTTGACGGAAGTAGTTTTTATTGCTATTTGTTTGCTTGTTTGAAAGTTTGTGAAAAATATTTTACTCGACATTAAAAGTATCCTCTTTTATAAACATGACGGACACTGTTTATGTAAAGA
TATGAATGCTTCTAAACCAAATTCATTAAATGAGGGACCACTGGTCCCTTGGTTTGTTTTGATGTCTCTAATTAAATATGATATTTTCCAAAACCATATGATCATCTGCTCATGCTAATC
ACATATCCAATGCCCAATTTTGCATCACTATCGGCTCAATTATGACGGATCTAAGTGGTTAAATTGAAATGCTTAACTCGATTAGCTCAGAATCTAGAAAATGTACTGGTTTTCACACGT
ACAATGATAGATTTAGAATGACAAGGACAGAGATGAAGAGAAATTAACAACAATAAGACACATTCTGTAAAAATAGAGGAGATATTGAAATGTTAGATGTCAGCGAAGTTTGATTCGAGA
ATGGAGATGTACATGATTCTTTGACCATTATATGTTATGTAAACATTCTGTGAAATTTGTAGTTTTCTATTTAGTATATTTATACAACTGCCCAACTGCCATTTAGACTAAAACAAAGGA
ACAGATTGCTTTTTCTTTACTCCCAAGTTTTTTCACTTTTCTCAAAAATTTAACAAGTTAGGTAACTTGCATTATGGTACATCCATGAGCATCATTACTTGTTTAAATAGAAAAATAAAC
CCATAAGACCAACCTGTTTGACCAACAGTGAGTAATCTAATGTTGTAGAGAGGAAATTTACTCAATATTGATTGGATTGAACTAAAGAGACAAAACTGGGAAATATAAAAGCTAAAATGA
GTAAAATGTGTACACTCTTTGCTGTATGTGATGGAAAATTTAACCCAACAAAACCTGGTTTCTACGTTCTGAAATCATAATGCCCTAACAAAAAGGTTTCAAATTTATTTGGGGTCAACA
ACAAAATATTACAGTAACTATGAAATTCTTCAGGAAGGGGAAGAAGAAGATGGCCCAAGAAGCTCGAGGAATAGCCTAGCAAGCAAACTGGGTTTTAAAGGAACTTGACCTAATTGATGG
AAAACACAAAAGCGGCCGAACAGTAAAGCCCTGAGATCTCTTCAACCACCAATTCACCATATTTCCGACTTGATATGAGACGAGCAAAAAGAACAAAGTGATCCTACTTTGTTAGTACCA
TTTTAACCAACACCTAAAGAAACACTGCACACAACTCTACATTCCTAATGGGCCCCAAAATGGACAACGTTTTCTCCTTTCCCCCATAATGACAATAAGTTTTGACAATAATCACTTTTT
TAACACCAATAGTCGAAGAGAAAAAAGAAGAAAAAAAAACAATACTCTATTCAGGCAGAAACGGGTTCCTCTACCCATCACCTAAACACTGTAAATAATTTAAAAACGTACACGTTAGTC
CCATGCACTAGTCACCCCTGAACCACTGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATCCACCAGAACCACCACCATAACCACCCCCACTATTGTTGTTGCCTCCACCATAATA
ATCAGAACCACCCCTGTTGAAAGAGCTTTCTCTTCTATAGTCACGGCTACCAAATCGGCCTCCCCCAGATCGACGGTTTCTTCCTCCAGTGTAGGCGGACCTGGCAGCAAATCGTATTAG
CCATTCAGGAACTTCCTGATTTGATTCTGACATCAGATCAGCCAAGGACCTTGCCAAGGATGCATTGTTCTCGTTAAAAAAGGCAGTTGCTAAACCAGTTTTCCCAGCTCTCCCCGTTCG
TCCAATTCTATGAACATAATCATCAATGTCATTAGGGAGATCGAAGTTCACCACATGTGCAACATGAGGAATGTCAAGCCCACGAGCAGCTACATCAGTTGCCACTAAAATCGGAGTGTT
GCCACTTCTAAATGACCTCAATGCTTGTTCTCTTTCCTGCAAGCACATATAAATACATAAAACAAAACCACAAATAAAAATATTTACAACCCAAATCCAAAATATGTTACAACACATGGT
CAAAACACAATTGATCTCAAATGCATGCTTGAGTATAGAACAATCATTAACGGTAACAATAGCTAAAACCATCAAATTATATCTTCCCCAGTTGAAGACACCTTACTTGATACTTGGAAA
CATGAAGTAACAATGACATCTAAAGTTTATAGATAGGATAACGAAAGAACGGAGCCAACAAGATGAAAATGAGTTATCACCATCTAAAACTCAAAAACCAACTAAGGTTCTGAATAATGA
AATTATCAAAGAGGAAGTAGGTGGAGGCCAACAACAGCGCAAGCACACATAAAATATAACATAGGAATCAATCGACAGAATCATCTGTACCTGCAGAATAATAGTGTAACCTACTTCTTA
AAGAACTTCAATTATTTGGTAGGCAAAACTATTCACCTATTTACACAAGATAACATATGAATTTCAACTGAAAAAAATTAGAGCCAAAATTACATATTTAGACTGAATTGAACTATTGTT
AAATCACAGAAACTTTAATTGACGAGGGATATCTGTGAACATAGGAAGGATAAATTTAAATCGACATACCTAGAGACTTCATATTTCCAACAAAAAAGCATTTAGAGTATTTTTCCTTTT
AGACAGGAAATGATATAATTCCTTTGATGTGAGAAAATGTACTTTTTATGGTCAAAGATGAGACAAAATATGCAAAAGAATGGAGGTATCCATCCCAAAGAAAAAGTATCAAAAGTCGTC
CACCTGGCACGAAAAGCTTTACACTACTGAAATGTTAGGGGTTCTTCCTTGAGAAAAACCCATCTCATGAGGCATAACTCATCCACCAATTTCAATAATCCACCTTGTTGAAAGAAATAT
TGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAATACTAGGTATTTGATCACTATNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACTCAGCCACTGTTATGATTGAAATCCTTCCC
TCTCAAGTCCTTATAAAATTCATGAGCCTTATTGACCATCAGCCCACGCAATTCTACACATTGTTTCCTTAATAGGGAGAATTTTATGTCTTAACCTACATAGACCATGCAAACGCACAT
ATATTTCCAAATAAAGAATAGCATAAAATAGAAGCTGCAGCCAATGTAGGCAGTAGTGAAGTCTGGAATGCTAGAGGATACCCTTGAAAGTTCAAGTTCAAGAATTCCTCTGTTAAGAGC
TACTTCTTCCTCCTTCCTCCTTTTTATTTCCATTTTATGTTCTTTTCATTTATTCCATTTATTTTTATTTCCTATAGACCCACCTTAAAAATAAAGGATCGCTTTAAAGATAAGGGGAGA
AAATCATGTATTGATGGAGCAGAGCAATCACAATTTCTCAATGAATTAAATATGCCAAAAACTGACTTACCTGTTGTGTTCTATCACCATGAATGGTAGTGGCAGGAAAACCATTGAGGC
ATAACCAATGTTCAAGAGCATCAGCTCCCTTCTTTGTCTCCACAAAAACCAGAGTAAGAGATTGCTGTCAATACAGAAATTATATAAGAATCTTCTTTCCTTAGCAATTTTGGAAAGCCA
AGATAAATGATCAATGTCTAAGATTTAATATCCTTTCCTAGAAATACGAGGTCTAGAGATGCACAACTCAATTAGAGATCAATTAATAAAATAAGCGATTATTTAAAAACAAAAACTAGA
TCGACCCGAATCCTCACAATGATGAAAAAATATGAAACATATACCTTGCCCTGCACACCATTTGCCCTCTGTGCGTGAAGAAGGTCCAATAAATGACTTCTCTTGTCAGCTTCATGAACA
AACTCAACTCTTTGAGCAATTAGATCAGTGCTCGAGCCCACTCTTCCAACAGCCAGAAATATATACTTATCTAGAAAATCCGAGGCAAGTCTCTGCAAGAAAAAAGTCGACTCAATATAA
AGTAAAACAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTATCTTTGTGTTAATCTACATCTTTTATGAGGATAAAAAATAGACATAACAAAACTCACTATGAAATGC
CAAGACGCTATGAGCACTAGAAAAAATAAGTTTGATGTTCGAAGAAGAGTGCTGAAAATACATGTATGCTCCCCCAGTTCTATACTATGTAAACACAAAAACTGCACTTACTTTTACTGA
AAGGACAAAAACTGCCCTTGGTTTATGGGGAGAAGGAAGAGCAATACCATTAAAAATATAATGCAGCAAGACACATAAATTTGTTCACTTACAAAAATAGTACCTGAATCTCCCTTGGAA
AAGTCGCACTGAACAGCATAGTCTGCCTTACCCCAGGTGGAGGCATGTCCATTTGTTCTACTATTTTCCTAATTTGGGGCTCAAATCCCATATCTAACATGCGGTCTGCTTCATCAAGGG
CCAAGTATCTTATCATCTGCAGTGAAACTTTAGCCCTTTCAAGCAAATCTACTAATCTTCCTGGAGTTGCAACAAGAATATCAACACCTCTTTCTAGATCACGTAGCTGATTCAAAAAGA
AAAATATAACAGGTGTCACAAGAGTGCAAACCAAGAAAAAAATTATAAACTATCAAATTCATAAAACACAAGAGTAGATCATGACATCACAAATGAGCCCTAAGATAACAGAAAGATAAG
GTATCACATCACATCAACAGACAGTAAATGGACAGAAAATAGTCTGTACTAGCAAAGGAAAATCTAACCAGTGTCATGTTGAAAAGATTTTTCACCAATTACCGTTCCACATTATAAATA
TACACTCGTGAACATTTATATTTATGGCTCAATTCATTCCAAAGTAATCATAATCAACCTTTTTCTCATGCTAAAGTAGCATTTACTCGATGAGATTATGATGAAATGATTTACTGTCAC
AAGTACATGTACTCCCTTACCCTTCACAACATACTGTTATACAAATATGCAATACAAAGGCAACCTCAGCAACTACATGAGCAGCACTTTGACACAAAATCACACATTGAGAGTTGCAAT
ACTTCAAATAGACAGAAAATGATTGAGAAATGGGGCAAAGGAACACAAAACCTGTAGGTTGATTGGTGCACCTCCATAAGCAACCACCACTCTGACCCCCGTTTGATAAGAGAATTTCCT
TGCTTCTTCATGTATCTAAAGCACAATAATTCATCCATATAACAAAACTGTAACAAAGAGTTTATGACTTTCTGCATAATCAAAAGAAAATGAAATAAATGTTCTCTTAAACAAAAAAAA
AAAACTACACTTGCATTGAAAGCTCCCTGGTTGGGGAGAGAATAAGAGCAAGTGGGTACACTGTGCGTGCACCTCGAGCTGGTCTCGGCATACTCTGGCCCTTCATTATGCCACTGATAA
TGGGGAAACAGAAAGCAGCAGTCTTTCCAGATCCAGTCTGAGCACAAGCCATCAAGTCTCTCCCTGCAAGAGAGATAGGAATAGCATGCCGCTGGACGGGAGTTGGTTTTACATACTTAC
ACCGTCGAATGTTTTGATTAAGTGCTTCACCCAAATCAATTTCAGCAAATGTATTCACCGGAGGGGGTACATTTTCACCACTTGTTTCCACAGGAATATCTTCATAAGCATCAAAATTTA
TACCAGTATTTTCTTGCTCTCCAAATGCTTCCTCTGTATCCTCCTCATCTCCAAATGGATTCACTTCCCGATCCCCCCTCCCACGATCCCATCCACCTCCTCTACTTCCCCCCCATCCTC
CTCCTCGACTACCACCACTATAACCGGAACGATTATTATAATCATTCCGGGGGCCACCACCCCAGCGAGACCCTGCATGTCCAGAACGATCATTTCCCACAGCAGGCCCACTATTTGCTG
CAGCAGGCAGATCAGCCGGGGCTGTGCGATTCCGCAGATGTGGTGGTACATAAGCCGATCGGCCAGGTGCTGTAGTAGTTCCAGCACTACAATTGTTAGCAGAACCAGCAGCTACATTCT
CAGCAGCCGAGCTTGCAGCCAAATCTGCCCACGAAGTTCGCATAGTTGAGACCCTTTCACGAGTTCAAAAAAAAATGTTCGCCAATCCACTCCAAATTACAACAAATTCTGCACATTATT
TATCAATAAACAAATTAACCCTCCACATCAGAAAAAAAATAAATAAACAGTTCGAACATGCATAAATACAGTCGATAACACAAGCATATCCCGATGCAAAGCTAAATCAACCCCACGACA
AACTCGATACCCAAACATAAAAATAAATGCGTCCTTCGATTAACCCAAAAAAAAAAATAACAAACATCAGACTCACAACTTTTTAAAAAAATATACACACATATTAATCGGTCTCAAATC
CCATATTCTTTTCAGCAAAAGAAATATAACCCAGAAAGATAACCTTGATCTGCAGCTACATCAACTAAAGAAAAGCTAAAGAATAAAACCCCAAGGTGNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCATCAAGAAATAAGAAAGAGTTTGAAATCATAACAATGCACGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNCGCGGATACCTGAAAAGTCGCAAAAATAGTGGAAGATCCAGGAACCCTAATTTTCGTCGTAGTAGACAACAGGGAGAGATAAAAAAGCGCCTTGCTTC
GAGAGAACGAAAACAAAAATATCTTCCTTTTGCTACGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCCTTTTTTTTCTGCTTTTCCCTCCCTCCCTCGNN
NNNNNNNNNNNNNNNNNNNNNNNNNNACTTTAATTTTTAAAAACTCTGGTTGGGGTTGGGTAAAAGAGTTTCAAATTAATCTCTCCCTAATTTCCTTTATCTTTCCCCTTTATATACTAA
AAAAAACTAAAATTACTACGTCCGTACGTATGTTTAATGGGATTAGCGGCCCTAATCCCTTTGTCTTCTTATCCTTCCGATTTTTATTCTTTCTTCTCTAATTCTATCCATCCTCTCGTT
ACTCACTCCCTTTTACTTTTACTTTTACTGTCCACTAAATTCTACTCTTACCCCCAACTTCTTTTTCTCCCATTTTTTTTCTTTATATTCCAATATCAATTTATTCCTAATTTTATTAAC
TTCCTTTCAAATATACCACACTCAATTTCATAACTTTTAATATTATCCATCTCATCAAATTTTCTTATATTTTGTAAATATTGTATACTGCTTTTTATATTACGAATATGGTAAATATGA
CAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCTAATTGAATTGT
TATTTGTTGATGTATATCCACTAAAAGATAAATGTTTGCAAATAAACGTGATTACTTTTAACACACTTCGATATTTCGATATTTATGATAGTGATAGTAAATACTATGAAAATAGTTGTT
TTATAATCTGATTAACTTGCTTTCGCATAATAAATTGGAATATTTATAAAGTGGGATAACTTTTAGTATTGTAGTTTCGAATATAATTCATCGNNNNNNNNNNNNNNNNNNNNNNGTTTT
GAGTACATTTATTATTTACAACCATTTTTCTTTAACTAGTATCTAATTTAAAATAACTAATATCTAAAAGATAGATGTTTGCAAATAAATATCAATTCATATTGATACAGTGATTAATTT
TTAACACGTTTCAATAATTATGATAGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTCCACCAAAGTATTGGTGTTAATGATACTAAATATTCGTGAA
GCATATCTTGAGACTATGGAGACAGTTGTTTTATAATTCTTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNGTAATATATAGTTAACTCTATCTTACAAGAAAATGTCAAACTTCAAAAGCACTATTTATTTATTTTAGGGTAACCTTGGCTTATTTTTTTCGTTAGTGACATCGACAATTCTAAAT
AGATCATTTCTCAACTTAATTTATGTGTAGGGTGATATAGTACCACCGATTTTTAAAAAGTTCTATTTGTTTTCAATGCAAACATGTGTTGGAAGGACATAAGTTCGTTGTGATGTATTC
CAAATATATTTAGCTAAAAAAGTTAGTCAAAACAAATTCAAATCATAAGATTACGTGTAGTTGGAAATAGTATTTTTCCTTAAAATACAAAAATTGTTCTCTTAGCTAATTGACGTGTGA
CTTTAGTTGTTTTCTTGACAATGCGTCCAAATTGAAATTATACGTATTATTGATTAATTAATTTCTAAGTGGTAACTCGTGACATTTTAGATAGTTATCGATAATATGGTTGTGTTTTTA
CTGCTAAAACTAACCACCATGGTTGTACTTTTATTTATAATATTATAAGTCTTCGTTAAAAAGAACAAGTTTACAGTGTTTTAGAATTTTGTTTGTACGTATAAATTATGGATTCTAAGG
TAACATGAAATTAAAAGAGGTTTTTACATCAATTTCATAAAACATTTTTAAAAACAACATTTGTTAGAATTGGTTGAATCAATTGGCATGAAAACATAATTTAGAACAACAAGCAAAAGA
AAATCTAAAAACGTTATCTTTGTGAGAATGTTCAACCTAATGAATGGGGATGATAGTGCTTATTCAAAGTTTGTGAGTCACACAATTCAAATAAATATCAAGTTTAGCTCTATTGGCTCC
TAATGAATGGGGATTACTTTTATTGTTTTCTGTCTAGGAAGTTGTGAGCTTTTATAACTCATGCAGGAAGAAGTTAATAAGGTATAAAAATGATGTTTGGTAGAACCTACAAACGCTTTG
GACCAAACAAAGAGTGAAGTTGTAACTTTATATTTTCTCACTTATAACTACTTTCAAAATTCCTAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTAATGGGATAAAATGTCAATAGTCTTGTT
ACATTCAACTTGGAGTGGATTTGAATTTTAAGGTTTTTATGATAGTAAAAAATGTTTCAAAATACCATAATCAACAAAACAATTATTAGTTAACATTGTCTTATCCAAATAGATTTTGAG
TCACGAAATACAAAATAATAACATATAGACATATAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATACCGATTTGTAAATACAAATCACGGTATTATTAATGAGAAAATAGATGTTTTAGATGTACATGCATGCA
TGTCGATATATCAAATCTTGCTATATTTTCAAGATTAAAATCTCATTTGAAGTAAATTGTTTTTAATTAAGTTTGTGAATTACAATTAACTGCATATAACTATAATTTTCCTTAGGTTTA
CTATTTTTAGACATGTTATAAAAAATTAACTTTCTTCTAAATTAAATTTGTGTTGAAACACTGTTTTTGTCTTTTAAATTTTACAAATAAGAAAATGATGAATATCCACCATATAAAAGA
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTAAAATAGATATTAATGATTATTAA
ACGAAACGTTACTAATTCATAATCATAAAGATTTTATAACTTTTGAACTTTAGACGTCGTAACTATCTAAACCCATGATTTAAGTTGTACAACAGAGTCCATTAACCTGACTAATTTGTT
TCTTTTACTATTATTTTATAATTTGATAAATTACTATAAACAAAATTGAAAGTTTATGATTCTAATAAAAGTGCAGTTTCACTTTTATTCAAAAGATTCAATCCAACCAAAAAATTGAAG
TTTACAAATTTGGAATACAATTGAAACCAATTTCCCTTTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAATACAAAAACACTTAGAGANNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGAACAAATTAGTTAATATCGAATAAGTG
ATTATCATAGTTATAGATAATCTTTATCCTCAACGATCATTTAAATAATTAGTTTTAGCTTAAACCATTTCGTTAAATTTTGATTTCTTTATTCTCACTTGTCCAATTTGCATACAATAA
ATATTAAATCGAGTCTTGCGTAAAAATTACTATCATGTAATAAATTTGAATAACAATTTAAAAATGGTTAGAAAGTGGGAGAACAAAAAGAATAAGAATTTAAAATCAAACAACATTTTC
AAAACAAAACAAAATAAATGTATAATGTAAATATTTGATAAAAATGGTTATTTTACAAAATATAAGGAAATTGGAGGTTTAGAATAATACAAGTAATGTTAATAACAAAGGGAAAAAAGA
GAGTAAAGAATGGGTTTGGGTGATGAGGATGGATGAGCATATGTTGGTGTATTAGGAAGGAGACGATGGTAATGGTTGAGATATCTCCGACGAGGGGCCCTTGTTTGAGTGAGGGTCTCT
CCCATTCCCCTCCACATTCTTTATAAAACACTTTTAAACTCCTAAAACGGACAACTATCTCTCTCTCTCACGCGCTTCTCCTTACGTTCTTCACTCACTTTACTCTTCCGCCACGTTTCT
AATTCAAGTCTCCTACAACCGACACGTGTACATTACGCGCGAAGCATGGGAGTGGGGGAACTATTATTTTCCCGGTTTTCGAACAAAATATGACATAAAAGAGTTTTCTTTATTTTCAAT
TGAGAAAGAAAGAAACTTTGATTTTTCCATCTTTTCTTTTTAGTAAATTACAGGAAGAGGACGGGGGAAGAAGAACAAGACGGAGTCCTTTTCTAGGGTTTTCCGACGGATCCTTTACGC
CTCAACGAATATCCTATGAACTTGAAGGGAGCACCACCGAATCGGCGGGATCTTGATCTGTAATTGCCATCGCTATTGGAGTCAAGAAATCACCTCAACCAACCTACGCGAAATCATGGA
TTCCCTATCTTCTAACTCTCACGGAAATCTGGACGAGCAGATTTCCCAGCTCATGCAGTGCAAGCCCTTGAACGAGCAGGAGGTACCCCCCTTTTTTTTTGTTCNNNNNNNNNNNNNNNN
NNNNNNNNNNNGTAATCTTTTGTTTTCGTTTTACATCGTAGTATCTAGAGATTGTTTGCTTATACTAAGGGGGTTTTCGAATGGTTTAAAAGCAATGTGATGGATCCAGCCTGATCTGTT
GGGGTTTCAGAACTTGGATTGAGGTAGTCGCGTGTTTCTGAGTTTTTGGGCTTGTGGGTGCGATGCGTGGGTTTGGCTATCTTGGAAGCATTTCCAGGGTAGATCTAGCGGTTGGATTTT
TAGAAATATGGTTATTCGGGAAAGATTTGCTCTAACGTGAAATAGATCCTTTACTGTGGTGCCACTGCAGTCGGCGTTTTAGATTTAACTTCCAACATTATTTAAGAATGTTTTACCGGT
TGGTGCTGTTTGGCTGATAATATAAGTTAAGAACGCGCGTCTTTTTCCTGACAATTAAGAATTCTGACACTCCCCATTGATCACAACCGTGTGTGTTTTTGTGGCATTTGATCTTGGTAT
CAAGTGACATCGATACCACGACCTCTAACTATGTAAATTGACTATTGATGTTGCACGTATGCATCTCCGCAGGTTTTATTGCAAGTATAGTTTGTAGCAGTCAATTTAATCTTTCCTGTT
TAGAAATGGGAGTGAGCATTTAGGTAAAATTGACCAGAGTTTCATTTTTAATGTAGTGAATTTTCTTGATATCATCTGAGAGCCGTTTGAAGAAAAGAAGGGTTGTGATCAGGTCAATTA
TACGGTATCAGTGATACATAGCATAGTCGAAAACTTTGAGTGGAATATATATTGTTGACAAAATTTGGGGTTATAGGTTTTATGAATATGTCTGCCAATCATGACATCCAGTCCATTTTA
GCTGGTGCCAACGTCTTTTCTGATTTGTTTGACATCAAGATAGGCAAAACATATATTTTGACGACACAATTCAATACTTGGATACCATGTTTCTTATTTCAAGGATCTCATCTTATGAAG
TGTCTCGACTGCAGGTAAGAGTATTGTGTGACAAAGCCAAGGAGATACTTATGGACGAGAGCAATGTTCAGGTATGCTTTATTTTGTTTCATCTCTTCAAGTTTTTTTTTTCATGCAAAG
TGTTCTATCATGGCCTCTTTTTCTGGGGTTTGAATTTATGCGGATGGAACATACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTGAATAAGTTATAAAACATCTTTATTTGT
TGTGGGTGCAATATGTTTAGCAATACTTCTGGGGAGGGGAGGGTCACTAAATGTTTGGATACAATTTCCATTGAGAACTCAAAAGCACTTCACTGTGATTTCAAAGAAACAATTTTGATT
AGTGCCATTTTTTACGGTTTCAACTTAAAATCTAAATCATTCAATGTTACATATTTGCTTTGACCAATTTTGTAATTCATCTTATCAATTAAATGAGGGAATAAATTTTGAAGTTCATTT
TTAGGTGCTTTTGACCGAAAAGTTTATCTTTAATTTTTCACAATGCACATTTTCTTTCACCAATTTTCAGGTGAAAGTTCATCCAATCAATTAAATGAAGGAATCNNNNNNNNNNNNNNN
NNNNNNNNGAACACCGATTTAGTTTTCCAAATATGCTTTCAGGAAAAAAGACACACACACACACCAGCAATTTAGTTTTACACACGTTTCTCTGTCTGTACATTTTATCTTTCTGATATT
GCTATACTCTTGTCTCATTTGATCTTTGCACTCTTTTGTACTAGATTTTCTTTACATCTATAGTTTCTCACGTCAATATTTTTGTTCACTCTTCCCCTACCAATCTTTCTCTCTACATGC
ATTTTCAACAACAAAGGGATTTACTATTGAGTACTTTTTTTTTTATCAATCTTCTGTATAATAGGAGTGTTCTTTCCCTCTTCATTCTTTTTCTTAAACAGGTCAAGAAGTTGTTTCCAT
TGGTGGTTTCTCTCTAGAATAATTTTGTAGCTCTTGTATTCTGCCTTTCACGTTCTTGTTTTCTTATTCAGTACTCTGATGTATTTTGCTCTCTCTAATTATATCGGCTTGTTAAGTTAT
AAATTCTAAAATAACCTTAGCTATCTATTCTGAGGTTCAAAAATGAAAATTAGGTCTAATTGAACTGTTAATTTATGATCTGGGGTCTGTCTGGAGTTCCAACTTTTATAACAATCATAC
TCTTGAACTTGCAAGTTTTCTTCTCTTGTAATTTGATAATGACGTGGTGGTTGCTGCTTAATTTTTATGTTAATACATTGAGGTTTTATGCTCTGCAGCCTGTTAAAAGTCCGGTAACAA
TATGTGGTGATATTCACGGGCAATTTCATGATCTTGCAGAACTTTTTCGCATTGGAGGGAAGGTATCTATTTTGACCATTGGCAGGATTTTTGTGGTTATCTTTGCTGAATGAGTAATGA
TTAAAGCGTTGGAAGGGAAAATATAAGCTCAACTGTGAAAGAAAAGCTCTTGATATGCTGATATTCTAGATTCTTGTTAATGTTGAATCATTGTGCTTCTCCAATTCAAGCTTAATTACT
GAGTAGATAACGAAGATTATTAAGTGATGGATGTAGATTGAAGCAAAAAGATAAAAAAGAAGGAAAAGAGGAGTAAAGATTTTAGTGTGCTTCTGTGTTGCTAGATGTTTGTTTCGTATC
CTTGAATATTACTCACAATAACATACATTTATAATTTATTAAATCAAACAGTTGATCTTAAGTTAACATTACACTGTAGTCAATGTCTATGTTTATTTCATACATCACACATGCATTTCA
TTTCGAGTTCCTTCTTGAAGTTCTAGCCTATAGTTGGGATTGAGGAGTCTTCCTTCTTTTTTACATTATATCACCCCATACAGTTCTTTATTCCTTTAATTTATTTCTGGTGGAGCAGTG
TCCAGATACAAATTACCTTTTTATGGGAGATTATGTTGATCGTGGCTACTACTCAGTTGAAACTGTTACAGTAAGTATGGCCTTGTTTAATGTAAATGTACTTGGTTTCGCTTCATGTAT
CATGTGGTAAAATTTGTTTGGCTTGAAAATTCTGGAGACATTGCAACATTTGAACTATTGTTTTAGGCAATGCATGGTTTTACGTGCATTATTTATGATTTAGACCCAAGGACAAGGAAA
AATAAATAAATAGCTGCAATGTACCACAAGTTCACAACATTCAAGATTCCAAAGGCAGTTGAGTTGAATTATTAAGTATATGAACTAGAATTGTCTTGTATTTCAATAACAGAAATTCAA
CATGTTTAAAGCCTCTTTCTATAGCATTTATACTTCTTTACTCGCTTCTTTTTATTTCTAGGATTATAGACTTGGAGAACCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACATCGACATCTCTACGCCAAGCACACA
TCAAACCAAACGTTTGGAAAAAAATATTTTAATTCCTTATCTATGAGGATGAGAAATAAAATTTTGAATTGATCCATGAGTGATGAATATATTGATAGACCCTATTCTTGAATGCAAATT
TGGGCTTGTCCAGTAAGTCACTGATACACAACTCCTTCCACCTGAAACAAAACAAGAATGGATACTTCTCTTGAAAGAATCACAAGTGAGAGTGATTTCTTCCCTAATTTACTTGAGAGA
TTAGAAATCATCATCATGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAATTGAGAGATTACAGGATCTAAACAAATTATCAAAAAC
AAACTAACTGGAATTTAACCGGCCCTTTTAACAAATAACAGATTTTCTTAACAAGATTTCCAGTTAACACCACAATGTTTTCATAGTAGGCTGTAGCATGCTTTTTGGGGCATGAACTCA
ACTTGTGTTCTAATATGAGTCATTTTACAGCTTTTAGTGGCCCTTAAAGTCCGATATCCTCAACGCATCACAATTCTTAGAGGAAATCATGAAAGTCGTCAGGTAAATGTTTATAATTGG
TACTGTGGCCCTTAATTTTGATGTTTTTTGAAGATGTCATCTTTAATTATGGTTTATGTTTTCTTTATGCAGATTACACAAGTTTATGGGTTCTATGACGAATGCTTAAGAAAGTACGTT
TTTCTGGCTTACCCTTAGTAGGAATTATTATTTTTCAATGTCCTCTTATGGGTCAACTCCATCTTGTCATCTCAGATTCTTTTTGCTCTGTGTTGCTTTTATTTAGTGCTACCCTGTGAT
GCACTTTTCTTTTGGGTGCTTATAAAGTTTTATTAAAATGGTTTGTTCGGATGCATTTTGACATGTTCCTTCAAATATGTTATCTTGAAAATATTTATTTACTATGTGCTGCTTATATTT
GAAGTTGAGTTACTTATCTTAAGATGGAAGTTATGTATGTGGTGCACAAGGGAGAGTATTTTTTTTTTCTGAATTATTTTTTATTGGGGTGAAGCAAGACTATCACGTCTGCAAGAAGTA
TGAAGAATATTTTGAAAAGGCAACCCAAGTATGACCTGTATGTTTTATTATCTTCTCTCTTTTTTCGCAGGTATGGCAATGCTAATGTTTGGAAGATTTTTACTGACCTGTTTGACTATT
TTCCACTGACAGCACTGGTTAGTATAATCTAAACATCGTTATGTATAATTGCATCATGGGGGTTCTTCTGTTCCTCCTTACAGCAATATGATCGCCAATTTTTGTTTCTGAAATTGATTC
TGATGCTTGTTTCTCTAATCTTTATAGGTGGAATCAGAAATATTCTGTCTGCATGGTGGTTTGTCGCCATCTATTGAAACCCTCGACAATATACGGAATTTTGATCGTGTTCAAGAAGTT
CCTCATGAAGGTCCCATGTGTGATCTCTTATGGTCTGACCCAGATGATCGATGTGGGTGGGGAATTTCTCCCAGAGGTGCTGGATATACCTTTGGTCAGGTAAATTTGTGAAGGCAACCT
ATCATCTTACATGTAACCCTTCATATTTTCACCACAGAGTTTTATGAACCCTCTTTTGTTGTTTCTCCAGGACATATCTGAGCAGTTTAACCATAGTAATAATTTAAAGTTGATTGCAAG
AGCACATCAGCTAGTGATGGAAGGATATAACTGGAGTCATGTAAGAAGTTTCTTTCCTTTGATGCGTGCATTGATCTTTTGTTTAGGTGGTGTGAGCAACTTAGAAATCGTCAATTGGTT
ATAACAGGAACAAAAGGTTGTGACTATATTTAGTGCACCTAATTATTGTTATCGCTGTGGAAATATGGCATCAATTCTGGAAGTTGATGACTGCAAAGCGCACACTTTCATTCAGGTATA
CCTCTCTTTCCTCTCCCTCCCTCAGAAAGGGAGCAACTACTCAGCCAGTTATTATGTTTTCCTTGTATGTGAACAATTTTTTTGCTTCTGCAGTTCGAACCAGCTCCAAGGAGGGGTGAA
CCGGATGTTACTCGAAGAACTCCTGACTACTTTTTATGATGCGCCTATTGTCAGATGAAAATTTCTAGCCGCAGGTGTTTCCAAACATATGTTTTGGCTGTTTTTACATTGGAGAATTTT
AGTTTTCCCTATGGTGGCGGTGGTGGTGGGGAAAGACAAAAGCATGTAAATTTCGATAGGTTGCTTTCAGGATGGTGGAGTCCATCCTTGCAAATCTCAAGGTTTTGCTGAAGGAAGCTA
TAGGGCTGGCGACTTGTTAACTGCATATGTAACATCTCCAAAGAACAATGTATTGTTGCATCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTAGTAATTTGT
TTCATGCAATTTTCCTATCCTTTGGTTCACGGGGTCTCTGTGCTTTTCTGTTTTAACTATTTTGTAGGATGCTTTTGTTTTAGTTTTCTTTTTGGGGGTTTACAGATGGACCATCACTTT
AATTTTTACTTCAATGAGTGTCTTTATTATTCTTTTTCATTATTTCCTCTGTTACTCTCCCTTTACCTTCCAATAGTTTTTAATCATTATTACTTATTACTAGTAAATGGAAACGACGAG
CAATAATCAGACCCAATTAGAAGCATTGTGTACGTTCGATTGTTGTCAAACCGATGAGTTCACACTTTTCTACTCTACACTTGGAAGTAATAATTCAGCTGGCTGCAGTATCATACAATA
TGGGTTGTGCAATGTAATAAATAGTCTATTCCAGATTTCGCATTGTGATGGATCTGTGTGTGGCTGCAGGAGAAATTGGACATTTCAATGAATTTCAGCTTAAATTTCTTCATTATAAAC
CATCTGAAGATATCTTTAGCAATATATTTCCTCATAACAAACCATTTGAAGATGTGTTTCACAATATCTTTGGATTTGTCTTTCATTTCATCAGCGTCAATTGAAGACTAGAGTGGGTGG
TGAAATAGATTTGGTGTAAGCAAGAGGCAGTGCAAGAAATTTCTTGGACCTCCCTACGTATGCTCGCTTTGTGAAATTGTTGTAATCATTTTCTTCAATTGCTTCCAATATTTCTCTGTA
CAACATCAGTGATGACCAAACTGGCCAACGGCTGGCCTTGTCAAGCTGAGAAGCTCCCTCTTCTGCTAGTTTGAAATAGAACCTCGCCCTTTTTATCTGTTCTTTCATGAATTCTCTCCA
CTCATCACTCACTCTCATTCTCAATATATCCTCGTCGCATAATCCAAATTGTGTAAGCTCGTCTTGTGGAAGATATACCCTCCCTCTCATTGCACTGAAATGACTTCAAAAGGCAGCATT
AGGATACGTTGTAAATAAAATAAATACCGACAATGGATTTACATGGTTCGTTAAAAAAACTTCATCAGACCAAACCTCAATGAGGTGGAAGAAGAGTAAAGTCACCATTAGTAATATCTA
AAACTCAAAATAACATGTGTCCCAACACCCTCCAAGAATTTCCAAATTGAAAGAACGAAAGAGACCTAAATGGCATAAAATTTAGAAGCATAACAAGCTACATGGTGAGTTGCACGATTA
CAAACATGAGGACATAATAAGGATAAAACATTTCTCAATTGCCTTGCTAAAGTAGCAATCTCGTCAAAGTTTGTTGAGCATTTGATAATCAAATCAACGACGTTCCTCCTAATAAACATA
TTTTACCACTAAAGAAAAAGAAGGGAGGACAAAAACAAAATCAGATTAGGCACCTCTAGTGCTATAGAGTTCATTAAAACACACTCATTTAAATCCTATGACAATCATAGTAAATAAGAT
AGATACGAGTAGATAGTGAATTCAAAACGTTCAGATATAAACAAAAGAGAGCAAAAGAGAGAGCTTACTCCTCTCCCACATCTCTTAGAATATTAGTAAGTTGATTCCCAATTCCCAAAT
GGAGAGCAGCACTGTAAACAGTATGAGTAGAAAGCGAAGAATCAGGTGCAATTCCCATAACAGGGACACTCATTAGTCCCACAGTTCCAGCCACATAATAACAATACAAATATAGCTCTT
CAAAATTCTCATATCTACACTTTTTAGTGTCCATTCTCATGCCTTCAATCATGTCCCTGAATGGCTGATTTCAGAAAACCAAAAAACAAAACAACAATAAGTATGAGCTCAAATCAGTAA
GAACCAAAAAAACGATAACTTTTCTCCTTAACTCACAGCACCTTCATGTCTATGGGAAATTTGGAGACTGTGTGACTTAAAGCAGCATCCAATAAGTCATAGGGGCAGCCTTCAAAAATG
TCTTCCAATCGTTCTTCCCATCGATCAAGAACTTTTGGATTCATATACATTGCATTGGGGCCATCCACAAGTTCATCTGTTCTCCTACACCAAACTACAGTAAAATAAAATACCAAAAAG
TCAGAACTTCTCCATGGATTTAGGTTAGGAAATGACCAAAACTCCTTACTTTTATGGGTTCTCTTAAAAAATGTTATCTGAGTGATTGTTTTTGGTTTCCGACNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNATTGTCTCTCTCACTAATTCTTGGTCTCCTCTCGCTCTCTCATTGTCTCACTTTTCACTCTCTCCAAAAAATGAAAATTAAATGCAACTTTAGAGGCTGATGATGTA
GACAAGAGTTCAAAAATAAGTTGTGAAAAGCGGGAAAAAAACTATTTTAGAGTTTGAGTTTGAGTTTGGGCATACTCTACAATTATCTCTGATTTTGTTTATTTTTTCCCTTTCTTTTTG
GCCTTACCATATATTGCCCATATTGCTCTCTGTCGTTCCTTTGTCATCAGCAAAGTTCCCAAATAGAAAGTCTTAGCATATTCTGCACAGATTTTCCTGCAACTCTCATAAGCTTCTTCA
AGAAATGAAGCCTGAAATTTCATCTTCCTCTTACACCCTTCTTCTCTTAAAAAATGGTTGCCTTCAGATTGCCTCTCCACAATCTCTTCAACCTTCAAATGACCCAAAGCAATTCCTTGT
TTTGATAAAGTTTGAAACTTCAACGTCTCACTGCTTCTGGGTGCTGCAGTTACCCCTCCTCCATTCCTTATAATTTTGAATCTCTTTGGCAAAACCTTCCCTTTGCATTCCCCAATGAAC
ATCAGAGGCTTTGGTGTGACACAAACACAAGAACTCATTCTTCAAATCTTTTGAAGAAAAACCCCTCCAAAAAAGGAAGTTTGGGTTTCAAGAGCTTTATAACCCCAATTATTTTGATTT
TGGTATATTCCAATGGTGTTCAATGAAAGAGTAGGATTGTGCAATTGGGAATTTGAGCATTTTTTTTTGCTCTCTTCAGTAAAGTTGGGAAGGATAAGACAAATAAAATGCCTTGTCTTG
AATAAACAGACTTTAGTTTGAAGTACAATAAATTTGTCTTGTTTTTGGGTCTTTATTTTAGAATCTTAATCCATATTGATACCCCCTTTATAAAACTCAACTCTCTCATCTCTATTCCAC
TCTTCCAATTATTTGTATCTGTCTTTTTCTTCAAAAACTCAATCCATACAGAACTTTAATCTTTTAGGTAGAAATGAGTGCCTCATCCAAAATAATAACAATAAAACTAAGTTATTCGTC
CCGTTTCGTGAATGCATGAATTATATTTGTGAATACTATTTAGTTTATTTATCATATATAAGTACATTAAACTCATAACTTATAATAACAATGATGATTATATTAGGGATAGGAAGATTC
AAACCATAGTTCTTTTGATCGCTAACACACTATCTTAGTTGAGTTATCACTAAAACTTTAACAAATTTGATTTGAGAAAAGTACATGTAAACCTCCGTAAGAATTGAAAATTAGGTCGGT
CGATGATGAAGAGATGGTTCCAACAAATTGAATTTAATTAAACATTAAGAAGAGTTGAAGGTGACTAAACTATTAAACTTATTGAAACAAACGAAAAATTGTTTTAAATAAAAACAAACT
ATATATTAAAAAGTGAAAGAAGAAAAAGCACAATCTTATAATTTGAAATTATTAAACAAAGTTTGGGTTAGTCATCACCAAGCGTTTGTAGTCCAACGGTTAGGATAATTGCCTTCCAAG
CAATAGACCCGGGTTCGACTCCCGGCAAACGCACACACTTTTATTGGGCCTCGTCAAGCCCACAAATCAAAACCCTAAACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTGATAT
AATTGTATTAGTGTTAACTTTGGTTTTTTTTTCTTATGTCGAATATAATGGTAACATATTGAAAAATGTAAATATATATTAGATATATTGTGTATGACAGATATACTTGTTAGGTTTAGT
ATAGAAGGATTCTTTTGTAAGTTAACGAGTTAACTATGGGAAAGCTTCCCATGTATGTGTAATTGACCTCCATCATATTATATACATAAAAGTGTAGTTCGTCCGATTATTCAAGTAAAA
CGCACTAGTAACACAATTAGAGAAATAGTTAAATTTCAATAGAGATTTTTGAAAAATAGCTAATCAGGTTTTTGTTTAGTAAACATAGTTACACTTAAAAGTAAAACATGATAGACCGTT
GGTCGTTGTCGGTGAAATTTTCAAAAAGTTAAATTGACGATGGAGTTAATCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATC
ACTCGTAGCTAAACTTAGAAACAAAGCTTTTTAGAACTATTCCTTAGTTTACGTTAAATCAAGAAGGCCATTTTAACAAATACAATCTAATCCTACAACTTTGGCTATATATATACATAT
ATTTTTTGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNAAACCCTAAACCCTAACAATTCCTCGAATATGTAAGACAATTTGAAACAACACCGAAGACCATGAATAAAACGTGTTCGAATAACTTAGGAACATCCAAAATATTGAGAATTAGCTTT
GACCTAATTGTTTGTTAAATATTAAGCTCTTAGGGAAGAAATTAGATTCACTTTAGGGGAACCTTTCTTTAGGTTGTAAATAGATGGAGAGCATGCATGGTTGTCCAAAATAAATCTCTT
CAACTCATCTTTCTCCAATACCTAACATTTCTATTTTATATATATAAGCGTAGATCTTAGTTGTTGTTATATTGTTCATTCCTTTTTACCCTATTTGACCTAATTTATTTAGGACATGTG
ATTTTCTTTCCCTATTTATATTACAATGACAAACATTTGAGATGAGATGAGATGACAAAATAGTGAACTAAATCATAATGTAGCAAAGTTGGCCAAAACTACTTTTGAATCTACCAAGTT
TGATTCTTTTGAAATTAATTCTCTTTAAAGCATATTGTACATTCCAATTAGAATGATATACATGCAAATACCTAATTTGTTATTTGATTGTACACGTGATAAATTCTTTTTTTAGATACG
TGTATGTTAAAACAAACTATTTAATTTATGTTTCGTAGAGAAAAATATCACTAAGAACTAAAATATGTTACACGCCAATTTTATGAATAAAATAATTAAAATAGNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTAATAGTTACATTTGCAATTATTTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNAAAAAATTGAAAAGTATTTTTCTTACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNCCATGTGAAAAAGTAAAAAAAGAAAAAGAAAAAAACGGAGTGAAATGGTAAAATATCATAATTTATTATTAGTTGGTTGAGTCATAATAAAC
CTCATGCATTTAATTAACAATATCAACCTTATATACATACTCATTTATTAGTTGAGATTTTATTTGTCCATTGGATCCCAAAAGCTCAACTATAATTTGAACCATCCAATCCGAGAAGCG
GGAGCTTTATTAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATATGCCAATAACTTTCATTACAATTCTTGAATTTTAATGTTGATGATGATTTCAA
GAATTTTCCTCATGGTTGAATGATAGTTCATAGCCAAGTCATTTTTCCTTATCAATAAATTCACACTTCTCTTCGACTTAGTACAATGGAGCACTTAAAAAAAAAAAAAACAGAAGATTA
AAACTATTTATAATTTTTTTTTGGGTATTCGAATAATTTTCATTTATTTATTTTTGTTTAAGAAAAGTCCTAGCTACTCTACCACAATATTACAATATTAAACAATAGAAATTTCTTCTT
AAGGTAATTAAAAATTAATGACATTGTTTTTCCCATCATTTAGTTTAGAAATCAAAATCCTTTTTCATAACAAATAATTAATTAGGATTTATTGATAGTGAGTTTTGTCACCATTGTCAA
CAAAGTCCAATTTTATAGTAATGAACACTTAATTTTTGTCATTTATTAAACTAATTGAGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTCGGAAGAGAAAAGCAAAATTTAGTATTC
TCTTATAGACTTATCAAATTCTTCTTTTTCTCCTCTCCTCTCATATATTTAATTTGAATTCCTAACTTTTTTGTGTATTTAATATAACGTGAATTACACGTTTTTTTAATTCTTTCCTTT
ATTTCATGCCTCTTTAAAAATTCAAAAATCACATTATAAAAATTTGATATTCAACAATAATAATAATATTTAACACCAAAGCAATCTCCTCAATTCATCTACTCATTAAAAATATAAATG
AATAAGATTCTAAGATTTTTTTTTGTTTGGAGATTAGACTTTAGAAATAAAATGAATGATCAACAAACAAAATTGGAGCAGCCCATGACGCATTAATGCTTCATAAAATTTTCAATTCTC
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTATGGTATCACATGGAAGNNNNNNNNNNNNNNNNNNNNNGAGGGAATA
ATGCCAATGACACTTTTTTTTTTCTTTCTAATAAATAAATCATAATGTGATTTTGACGTGAGACTTATTTTAAAACTTCTTATTAAAATAATAATTTGGTAAAAGAAAATAAGTATTTTA
AATTGACCGATAAAACTTAAACTTACAAGTAAAAAATTTAGAAGTAAAACGAAAATTTATATGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCTATTGAAAATGATTTT
GAGATTATTAAAAATTTATCTTCTTTTTTTTCTGCAAAGATAATTTAAATAATTCAAAATAAATCCAATTAAATGTTTGAACTATAAAGTACAGCTAATTAAAAAAGAGAGAAAATGTTG
TAGATAAAAATGAGAAATAAATATTGCAACCCCTTTTTCTAAAAAGAATATTTTGGCCTTAGGATTAGTTTTTTCAAAAATCATTATTACGGAATTGATAGCATTTAATTGTAATTAAAG
TCAACTTAAGAACAAAAGGAAAAAAAAGACACTTATGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAATATCTCTTGTAT
AATTAGGTTAATTGTTATTCGTTTTAATAAAAATGTGTTGATTTGTTTTCTTTTTTTTACTTTCACTTATCATTTTTGGATTTAATATTTATTTTGTGGGTGAATTTACATAACCCTCAG
GTACTACTTTTGTTTTACCATCAATTCTTTTTGTACTAATTGATTGCTAATTTTATGTTATGTTTCAATATTATTCTTAAATTAAAAGTTTTGTTTTCTAAGTCGACTTTCTATGTTTTC
AATTAAAGTCCAATTGAATTACTATAGGAAAGAGTACGTAGAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGCATGAGTTTAAATAATATATAG
TAAAGTTTGTTGTGTAATTTGGCATCTATATTTAGGCTATATGGATAAGGATATATATATATAAACCCCTTCTTGAAATGAAAAAGAAAATGTGGAAAATGGGAATAGAGAAGGCATCAC
TTTAGCCTTAAATGAAAAAACCCAACCCCCGATGTCGAACCGGCCGGGTCCATTACTCTCCCATCCCTCACCGCCACACCACAACCCTCTTGCTTTCATTAATTCCCCTTTCTTTGTCTC
TCTATTTTTTCAATGTATAGAGTAAAGCAATTTTAATTAGAAGAGTAAGAGATTAATTAGTTAAATGAAATGAATATGAAAGATGACAAAGTTGTGAATAAAGAAAGAGAATTGAAATCC
AAAAGGAAAGATGCATTTGATTTTGGATTAGATCAAAAAGATTGGCTGGCAATGATATTTTGTATATGGTCGATTTTATTGCTGTTTTGGTCTAAGCAAATAGATTAATTAAGATGTGAC
ACAACCATGGTGCCATTCTTTGACAACTAAGGCCCCATCTTATGAAAAGTATATCAAATCATATAAAATATATCAAGAAAATGTGTCACAATCAAACTAATTAATAATTGGACTCAATCA
CCCTACCTTATTATTATTATGCCGACCTCTAATCTATCTTATTCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATTGTATGCCTAAGGTGTTTACATTACACTCATCTTTCTATCATC
TATATATTCACATCTTTCTAATCACAAATTATCATGGAATGATGCTTTAGAATGTATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATGTAGTTTATAGNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATCATTATTCAAGAGTAAATTTGGAATTTATAAAAACAACATTGATTTTAAATATTTGGATGNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCAAAGATGGGGGATTTGTGTCATTTAATGATAGTTTGAGTCCTAAAATTGTAAACAATTTTAGTGAAGGGGTTTCTT
TAGTAAATAATTAAAACAGATGATGAGTTTAATTAAATAATTGAAGGAAAGTCAAGAAGGCATTTGGGTGAATAATAAATATTAGTTTAGTTTTATAGTAAGAAATGATGCAATTAATTA
AGATAATAATTAAAAAAGAAAGCTTTGCTTACATCGGACAGCACACTTCACCATATCTTTCCCAAAACCCAATTAGTTTTTCTAAAACGATAAAATTAAACTATCAAATGTTTTAATTTC
AACGCCACCCTGCTCATTAACCCATTAATTTAATCCTTAATTAACCCATTAATTTAATTCTATTATTATGCAAGCAAACATCTATACGTTACTCTTTTACTATTCTATTAAAACTAACTT
ATAGAGTTACCATTCTCTCTTCCATTCTCTAGTTTTTAGAGTTAGATTAGGGGAACATGTTCATGACAATTTCGTTTTTGTTTTAAAAGATATTTTTCTCTCTAGTAAGAAAAATTAAAA
GAGTGAAGAGCATGAGAGTTAGGTGTAACGCCCTAATCATTATTTGTTGGATTAAAGAGTTTGACCAACTGGTCGATCGTATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATAATAATTTATTTTAAACAAATTATGT
TCGCAGTAGAATGGCTCTGCCTCTACTCTTACAACCATCAAGTTGTGGCTTTGTGTTATGCATTTTTCCGTTTACTAATAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAAAAGGAAGGAATAGAGTAAAATATAGGTGATGATTAA
AATTGAGGAATTAATATGAAATAAGCAAAGGCCTTATCCCTATTTCCATCTAAGTTTGAAAATGGGAGAAAATGACAATAATAAGTTCTCCTTGAAAAATAACACATCGGGGGCTCACTA
TTTCATTTATAAAAGGTTGACGACGATGACGATAAGACATTAAAGTAAACCAAACGTGTCACAATTAAACTAACGCCTGTTTTAATCATTTTACTTTATTCATATACAAATNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
AGGTCTTGGTGTTACTAGATTATTATAGGATGGTGGGAGACTAATTAGACAGAAAACAAAAAAAAACAAAAAAGTTCATGGACTTATTAAATACAATAAAGTTATTTAATTGAGAGGTTG
ATTAGAATAATAGAGAAATGAAGAAAAAGAGGTGAAGTAGACTCACATATTCCCACAAAAGGATTGGCATCATGTGTAGAGAATTAAAGATAAAGTTAAGATGATATGAGTATGAGTGAG
TGTGACAATCCAAAAGCAATTCATATATAAAAATAATGCAATAACTAAGAGAAAGAAAGTGACATTGTTTGGCATTCCCACATGGAAAAACTAAAACCAATATTCAAANNNNNNNNNNNN
NNNNNNNNTATGAACCCTTTTTCTTCTTCTCTCTCTCTATTTAAACAAATATTTTCTTTAGACAAATAGACTTTATGGCATGTGATACCCAATTATTTTTTATTTTGTGTGGACTCCCTC
TTCTTTTCATTGCTTTCCACATTTAACTTAGTTTTTCTTTTTTCTTTTGCTTTTTACTCCCTTTTGGGTCCCACTTTCTTTGCCTTTTGATCCCTTCATACAACTTGTTTCTCTCTTTTC
ACCCCCCACAATTTGCTTTATTCACACTAAAGTTCTCTTTTTCACTCATTGTGTTTTTCTTACTTGATTGAATATTCCCTTTATTATTCTTATTAAATTCCAAAAACACCTTTTTAAATA
CATCCTAAAATCTTCAATTCCAATTTCAATAAAATCTCAAAGAAGAAAAAAAGAGTTTGAACATGATTGAATAATTGGTATTAATTTGGACAAGAAACCGAGTAGAAAAGGTTAATAGAT
TTTGAATTCCTTTACCCCTTACTTTATTCATTCTCTCATGCTCTGCTATAGTATCAAAGTCATAACCTTTAAATTCAATTAGCACACATAACGTATTAAATAAACAAATAAAGCAATTAA
TTAGATTGACCATTTAAAATAATAATGGAATTGGTAAAAGGGAAATAAACTCAATAATAGAAGTCAAAATACACTTTATTTAAAATTTGATAACTAAACCCTAAAAATTGATTAATTTTA
GTAATTCATCCAAATGAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGTGAAAATGGTAGCAAAAATGGAATGAATTTAAGATGATTTATGGAAAGTTGAAAGAGTAAAAGGGAAAAT
AATATATAAAGTTTGATGATAATTAAAAGTAATTAAAAGGAAAGATAGATATAGAAGTAGTTGCTTATTCACTATCAAAGCCATCAACCTTCTAGAAGCGATTTGGAAAATTGGGAGAAA
AAAGAAAAAGGTGAAAAACAAAACACTGTCCTTTTCATAGCCATAATGGACAATTTGGAAAAGCCCTAATTTTCCAATTTTTGCAACTTGAGAAGTGCTTCCCTACACNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGTATATATATTTTGTAAAAGACAATATTAAACCTTCTAGAACCTTTTTTCCCCNNNNNNNNNNNNN
NNNNNNNNNGAAAAAGAAAAGCTTCTAGAAGACTTAGCTTGTGAGTGGTGGCAATCAATAATTCAAATCCAAAGGAGAGGACTTCAAATTTTAAATGTGTACCAAATTAATGGGTTGGGA
ACTATAATCACATACATTCATTCAAACTATAATTAAAAGTCTCACCCATCTTTTAAAAGTTTTAAATGTGTTTATATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAGCATAT
ACGAAACCAAAGATTTTAAAACAAAATAGAATAGAGAGACCCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGTTATCTCAAATAAAAGATAAGTAAGTTGTTTATTATTA
TTAGTGGTTTGCTTATTATTTAATATTAGTTATTTGTTTCTATAACAATATCAATCTCAATTAAGGGAAATAATGTTAATAATTTTCAATTGAATGTAGATTATATGTATTTTCATAAAT
ATATTTGATAATAACAAACTCATTTATGAATATATTTTCATAAATATATTTGTCATATAAATGTACATTTTTTTTTTGTTTATAGAAGCAAAGATTTGTATAAAAACAATTTAAAGATGT
TCATGCGGGCAATTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTCATATGATTTATTTATAAACATAAACAGTTAATTTAAATC
ACTAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTACAAAATTGTTTATTATAGTTAGTTTTTATATGATAACTGAGTTTAAACATAAATCGGTCAAATTTTGGCGACATGAAGTCGAG
GTCACGCCCTCATTTAGCTCAAGGAGAATTTTTTTCTCACTCCCTCCGGCCCCTTGAACTCATGAGACTCATCTCGAACATTTCTAATCGTAATGGACTATAACTCATGATTTATTATGG
ATAGATTGTTACATTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAAACAAAATGTTATTAAAGGAAGAAAAGGAAATACCCACGAAAATATTCTGTAGTACAATAAATTAAAGAC
TGAAGTACTTGAATATAAAATCACAATAAATGCAATATTACTATAAAACATTTTCTCAAAAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGGGATGCN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAAATGCTATAACCTTCAACAAAAAAATAAAAAATACCAAATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACTATAGAAAATTA
AAATTAGTTGAAGGATTTTAAATAGTATTTGATAGTTATTATAAAAGGTGGTCTAAAATTTTGTAAGATCAAATTTAAGTAGAAGAGTATAAATAAAAGGTTATTTGAAAGAAACTATTT
AGGATGGATGAAAATATTTTATTTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAAGCGTCTAAAATGTTGTGAAT
ATCATAAATGCAAGCCTATCCACAACAATATGAATTAAATTAAAAGAAAGCTTTCACCACCACGTGTCAGTCTTCCACTCGATTAACTCTCTCCATGGGGCCACCCAAAGCTGACTTCCC
TAACCAAAACACTCTCTCTTCTTTCTTATCCTTTTCTATACACTAACTTTTTCTTTTTTTTTTATACTCTCTTTTTATATTTCTTTTTACAATTTCAAATTAATTCATTTGCTTTAACTA
AATAATATTTCCCTTTATTTATTTATTTGTTATGTACTTTTCATACATCTTAATACTAATCGCTATAATATAGATTTTGTACCACAAAAGTTCTAAAATATTTACTTTTTTTTTTCTTGG
AGAAAATAAATGAGTTATTAAATATTTTATGAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTTCTTTGTATTGGGAAAAGGAAAGGACGATTTAGTCCTTGAGAA
TTAAAAGAAAAAAAAGGGGGGGATAAGGAATGAATTTGGGCCATCAATAATTTGTTTAAATCTCAACCCTTTTTTCTTTATCCTTAAGGAATAAATCCAACCGTTAATCCCATGTGGAAT
TTGGAGAAAATAAAATCTTCATTTTCCGAATTATTAGTTATCCCTATAAATATGAGAGTGAAGCTAAGTGATCTTCGGCATTCAAACAAAATATCAATCCCTTTTTTTTTCTCTCTCTCA
ATGGAAAACTTCGAATCCAACTTCACCGAGTTCATTCCGGGTCTTCCTGAAGAACTCAGCCTCGATTGCATCACTCGTTTGCCTTACACATCTCACCGTCTTGCCTCCGCCGTTTGCCGC
CGTTGGCAGCAACTCATCTCCAGTCCCGATTTCTATTACCACCGTCGAAAATCCGGTGCCACTACTCTTCTCTCTTGCTTCATTCAAGCTCTTCCCCCAGCTTTCTCCACCACAGGATGG
AAGCTTTGTACTTCACTCGCTTACGGACTCACCGTTTTCGACTCACTGAGTCAATCCTGGGACCGAATCCCTTCGATTCCACAATACCCAGATGGTCTTCCTCTGTTCTGTCACATAGCT
AGTACCGAAGGAAAACTGGTGCTCATGGGCGGCTGGGATCCAGCAACTTACGACCCGATTATTGATGTTTTTGTTTACGATTTCACCCAAGGTGCCTGGAGGAAGGGGAAAGATATGCCA
TCTAAGCGATCCTTTTTTGCAATTGGTGCTTCCGATGGAAGAGTCTACATCTCCGGTGGCCACGACGAGAGCAAAAACGCCTTGAAATCGGCATGGGTTTACGATCTGAGAACCGACGAG
TGGACTGAGTTGCCCCAAATGAGTCAGGGGAGGGACGAGTGTGAAGGTCTGATGGTCGGCCGTGAATTCTGGGTTGTTAGCGGCTACGACACCGAGCGACAGGGGATGTTCGACGCCAGC
GCCGAAGTTTATGACCTGGATTCCGGGGAGTGGCGAGTAGTGGATCAGGCATGGGAAGAAGGCCGGTGCCCGCGGGCATGCATCGGAATGGATAAAGACGGAAAACTAACGAACTGGTCT
GAATCAGCTCCGGCAGTGAGAGTGGGAGCGTGTGGGATGGTGATGGGAAGCCGGACTTTAGTGACCGGATCGGAGTATCAAGGGGGGCCGCAGAATTTCTATGTGATGGAAGGGGAGGGA
GGGCAAAAATGGTAAAATGAGGAAAATTAATGTTCCAGAAGAGTACGGTGGATACGTGCAATCGGGATGCTGCGTCGAGGTGTGATTGATGAAAATATCGGGGGGCAGAGGGTATTGACG
TCATTTTGCTAAGTTTGGGNNNNNNNNNNNNNNNNNNNNNGTTATCGACTATGTACATATTTACATACAGAGTGGGAAGAGATTACGAAATTTTTTTTGGTATGATGCGTAATTAAAACT
TTCCTCATTTTCCAATATAATATATAGTTTTTGGACTTTGGGCTAATTCTTGTGTGGTGAATTTATTTCTCATCGTCTATATCTCTCATCTTTTTTGTATGNNNNNNNNNNNNNNNNNNN
NNGTGCAAGTTTTCTTGTAGCCGACAGTGAGCTTAACTCCTCTGTAAACAACTTTTTTTTTTCTTTTTGTCATTCTCGAAGAAAAATGTAGGGAAATTTAAAAAATGCACAACATGGTAT
TGAAGCAAGATTGATGTGTCCAAAAGTATGCAAATAAGAGTTTTGTGAGGTTAGAATTAGACTACATTACTTTATTTGAATTTGAAAAAGGGTTTAGAGCACTTGAAAAGTGTTGCAATG
GATGGTTTGATTTAGAGTCACTGAAATGAGGGTGTTCAAATTTGGAGTTGATAAAGTGGTTGAGGTATATAGATAATTACATCCAAGGTTGTTTGAGTATAAGTAACCCGATACAGACTC
ACCACTAAAGAAGATCATTTATTTCAAGTTAGAAATTAAGTGATTCTAAAACATATGACTAAGAAAGTACATCTCAGGTCGTTTGAGTGAGTGACCAGACTTTGATTCACCACCATCACC
TATCATCTATATTGAATTCGCTGTAAATTAATGCACTTACAAAAGTTCGATTTAATACAGCTTCCCAATTACAGAGGATAAATTAATTCCACCCCCCACCCACCCCCAGCCCCACTATGC
ATCCTGCTATAGTTTCGATATTTTGAAATACCAAACCAAAATGAGAAATAGGGTTTTTAACACAAAATGCCTTTCAAGTACGAAAATGCAGTGTTTTTAACACTTGAAATGTCATTCCAC
GGTCTCTTATAGGGTTTAGAAAAGAGTAGCCTTAGATCTACTTTTAAGCTTCAGGAAAGAAATGAAAAAAGAACATATGTATATACACACATGCATATACTTTTTTATATATATAAAAGT
ATAAATGAAGAAACAAACACATAGCATAGACAATCTGGCAAGTGAATTCCACTCTTACACACCACGTTATCCAAGTCCAATTCAATATGGTATTAAAACTAGATCCATTGTAGAGAAAGT
TCCTTTCTATCCATGCAAGTGATAAATTTTTTTAACCAATTTTATAAATCAAAGTATTTGATGATCAAATCAATGTTTCTATCTAGTTAATGTCTATGGGTACAAATATCATGGCAGCCA
CCAACAAAGCTCTCTTAGTAATCTACAATGGTGAACTCATCCCTTTGCAAAGCTGGTTTCATTGAGTGTTTTCCTAACCCTGTCTCACATATAGGCATAGACCATCTTCAATAGCACTCA
CGGTTCTCCTGAAACAAAATAAAAAAGATACCGATCAAATCAATGCATAAGTTTCCTTTTTCATTTCGATAACAGTAGGTGTCCAAATTAGCTTATGAATAGCTCAACTTATGTTGGGAG
ATTGCTTACTTATCCTACATATTTGATATAAGAAAAGATATATAAAATCAAAGCATAAGCACCCTAAACTGATTAAAAGGAACAGAAATATACAACTCAAACCCCCGCACTTAAAACAAG
GCGTTAAAAGAAAATGAAGTATATATCAGCTAATCAAACGGTGTTACCAATCAATTTACACTATAGTTGTATGCTAGAGTTCTTCTGGGACTGGCACACTACCATATGAGACATGAGTCT
TCTTCCACACTACCCAAATAAATTTGAATAAAGATTCACAAGACATGGGTATCAAATAGCAAGACAGAGTGACAGATGAATCAGCATCACTTGCTATGCAAAAAGGTTAAAGTTTGAATG
TTTTAAAGTCTTCTATTAATAACATGCAAACAACGAAAGTAAAGGGCATGCAATTTCTAATCTTTCCAAGAAGATAGCTACCATGGATTGCAATAACAAACAGAAGCTATATGATCATTC
ATTTAATGAATTTCTCTATCTAGTAACTTTCTAGTTTAAATTGACTTAATAGCAATTTAACATTCCTCAAAAATCCAGAACCAACAAAAAGAAAGGGAATCAAAATGAAGTCAAATCCAT
ATTGGAACAAAGAGACAACAAGCCAGCCAGAACCAGAAATCGAGGATGGCTAGCGAAGTGTGGACTGTGAATTTTCTTCTTAGAATCTTATGTGCATCGAGATCAAGAAAGATAGTATAC
CCTTATCAATGACAAAGGAAATTTAGATTGGATAAATGAAGATTGAATCGTATAATAGCCGTAAAGGAAATGAGGAAATGAACAAATGCAATCCAAGCTGGAAAAAATTATCTCAAAAAG
CTAACTTTAATGTTGTTTGTTTATGGAAACAAATTTGGCAAGTGAAAACAGTAGTCGTTGACTGATTAACTGGATATTCATAACAGTAAAAGGAAAAGACATCAGAATCAAATTCTTTCA
AGACATTCAGTCAGACAAGAAAAAATAAATATCCAATCAAACAACCTTCCGTCTAGCGAAAGTTTCATAAAAGACTGTCACGAACTCAATCAATCGCAATAGAATGTAAATTCCTGCTTA
ATCTTCTATCATATCACCGTAAATCATCTCCAAAAGAATTGCTAGCACAAACATTCAACGTGTGATCGAAGTTAAAGTTACTGAATGAATATTCAGGCGCAGCTAGGGAATTCAATTATC
ATAGTGAATTCAAGGAACTAAACCAAAGCATGCCCAATTAAGAAAAATATCAAATTACAGGACAATTTCCTAAAGATATACGTACCTTCTCACATATCAGATCCAACTCGATCAATCACA
CTTACAATCCAACTTCTGTCTGGCAGCTCTTGCATTATCATACTCGAATTTCAAAACATTACTTATATGAGAAGTGTCCTTAATGTAAAACCTCCTGCCAAATTGGCTCTCCTCTATAGC
CGGAAAGTAACAGAAAAGCACAGAATTGACAAACGAGAACCACAAAGCTCCAAGAAGACCACCAAGTGTAGCTCCAGCAAAAACCTGTGCAACAGTATGGTATCCTAAATAGACCCTCGA
ATACATGGTCAAGAGAGCCAAAGACCAAGCCAAGAGATTCAATATCCACTTGCTTTCAGTACCCCAAAGTCCAATCCCTTTATAGGACAAAAGAGTGAAGTATATAGCAAAGAAAAACAT
ATACTGAGAGTGACTAGATGGCCAACCATGCGAATCACACATTTCCAACAACGCACACGTCTCAGGACGGGCTTGCTGAACGGAGGTCTTGATGAATTCATTTACGAATTGAGAGATTAC
AAGCCCTAGGGCGAAGAACATACCCTGTAATTCGCGACGGAAGATGAAGTGAGAGAGAAATCCACCAAGACTAATGAAGACGGGGACCAAAGAAACCCAAGCTAAGAAATGGCCGAGCTG
ATCTCCCCTCTGGTAGCGGACATGGGTCAAAGACACAGCCTTGAGTGGTGCCGCCGCCATGGAATTAGTGGAATCAAATTTCAAAGGAGGAACTAGAAGGAGAGAACCATAAATAGATCG
GATCGGAGAGGAAAGGAATTCGAATGCGTGAGATCGGAGAAAAACAAGTAAGATTTGTCGCCAGGGAGAGAATCGAATTAGGAACGGGCGATGCAAACTTGAAGTGGTGGACGAAGCAAG
AAAATGCTGCAGTGTTATTTCTCAATAAATGATATTTTATGTAATTAGTTTGCATAAAATAACATATTTTCAACCAAATAAAATATTAAATTATTCATCAAATATACCATACCNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATTTACAAAATGTTGTTCATAAATTTGAACAGTGTGAGAAATCCCTAGAGGAATTTTATACACCCATAT
ACGTATATGTTCATTGATTAATATGTATGGTTGTTCTAAGTTTTGCTTCCAAAAATAATATGATCAATCATTCATCTTCAACTATCCTTAAATGATAACATATATTATAAGAGATTTTTT
AAAATTAAGTATCTAAATTGACATTGTTTTTTTAGTCTAGTAATGACAACCATTGCACTTATGTATTTGGCAAAATATTGTAGTGTTAGAGATCAGTTTACTATTGTATACAGAGCTTTT
TTACGTAATAAGCTTTATGAATTATCGTATAATCTTATATATTTTGTGGTTCCCTAAAATGACCAAATAAACAACTCTAAATGGTAGTAATATCATTATAATGCAAAAGAAAAAAAAGAT
TAGAAAACAATTGTATAGCTTAAACATGTATTTAATAACTCCATGTTAAACAAATTAACGATCCAAAACATCTAAAGCCTAAACTCTAACTAAACAATTTGCACCTACACACCCATCCTA
AAATTGGACTAAATTATTAGCGTTATCTCTATTGGTGCTTCTCTCGATGAATGAACAGATCATGTAAACATTAAATCATTGATAAATTTTGAAATTTTTTAAATACATATGGAATGAATT
TTGAATTTAATACCTTGCAATTTGCTTGTTGAATTTATTACCTTCCAATTTGCTTGTTGGAACTTTTATTACCTTGCAATTTGCTTGGAAGCAACTTGGTGTCCTTTGTATTAGTTTAAT
TCAAAAAAGTATACTATATAAACTCTGCAACCTTATGGGCACAATTTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATGAATGTGTAACTAAGTATTGTCAGTGAACCACGTATATA
TATTCTTTGTTTTCTGAACAACAATATACCTAACCAAACCAAGGTTGTGATGAGATTTTAGCACGATGCAAAGTTGCAGTCCCTTGCAACTTTAAAGTGTTATGATTGTGGAAGAGCTCA
TTAATTTTCCCGTCCTTGTTTAGAAGTGTTCTTAGGAATAGATTTCTTTGTTTTACCATGATTTTGGCCTAATATTTTCTACCACTGCATCATCATAAACCATAAGAAATAAAATTGAAA
AATGGAGTAAGGAAGATTTTGGTCCCATCTAAACAATTTATGCAAATTCAGGAGAAGAAAAGTTGTTACAGATGGATGATGTATACCCGTGAGAAGTGATTAGCATTGGGTTAATTAAAG
CAGTAGCAGAGAATTAGAAGAGTACTTAGTCATGGAGAATGAGAATGGGAGTGAGGGTGAGAATGGGAGTGAAGGCTATCAAAAATATCAGCAGGAGGAATAAAGTAGTCCATGCTAAGA
CCAGCAACGTTAAACATCACATCGTCAATACTCCAAATCTCTTCCATGCGAGTCCTGCTAAATTGGGTGGACATTTCCCCAAACTTGAACACAGTAGCTATAGACCTGCCACGGTGAGCG
ATGAGGACCCCATCCACGTCTCTGTAATCCCCAATGCAGCTTCCAATGGTCGTTTCCCAGTACACAGCATCGCCTTCAGTCTGGACCCTGGTTAGATGCGAGTCCTCCAGGTACACTAGC
ACTCCACTCTTTTGACAGAAGTAGCCATATAGTACATGCCTTATCACTTCCGCAGGCCCCTCATTCCTCTCCATCACTGCCTCCCTCTCTGCCGATACTTTCAGCACAAAGCAATCGTCT
TCTCCGATTCTCTTTTCTCCCAGACATTGAGCTTTCTCAAACAGCCTCGCTGTGCTCTTCGGATCTAGCCCCTGCCATTGTATATCAATAACTCAAGACCCAACAAATTAAAATCAATAA
TGTTAATGCTACGTACTGTTTGTTTCTTCATGTTATCTTTACACTTTGATGGTTGCAGTTTCTAAGTCTCCAAGAAAGTTTAAGATAATAATATGGTATTGGTATAATGGTATTTCTAAA
ACAAATATCAAATTGTTCTAAGATAACATAAAAAACAAAAATAGATAGAGGTAATTAAATATATGATATAGCTTTAATGAACTTACTTCCTCCGGCGCCTCCTAAAGAAAGAAATGCATC
TCGAGATAGGTGCAATTACTATGGCCTGGGTGGCCCCATTCATATTAAAATATTGCAAACAAATCTATGCCATTGGATTTCATGATCATCATTCTTCGTGATTNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAGACACAAAATACAAACTAACAACTGTTAAAGGCAGAAAGAGAGGGACAAAAAGCAAGAGCAATTGGGACCCTT
GAATGAAGAAAGACAGAGAGGGAATGACGTCACTAAGAATAATCAATCACGTGCCATCCATCCCCAAAGATCTGAGTGTTTCACTATTGGAAAAGCATAAATATGTACGATAAAGCAGGG
GACAGTTTCTCTATCATTGTCAGCTATTTCTTGGGATTGTTCATTTGTTGACAGTCTCTGTCCTAACCCATTTCTTCTTTCAAAAATCTCTCAATTACTAAATAACCCCACATCTCTTTT
TTTGTTTTATTTTGATTCTCACCATCCTCTCATTCTTGTCGTTGAAAATGGTCAAACTTATACCCAAAAAAAGACTAAAAAGAGTGTGTGAAATGTTTCATACTTAACTCAACTGCATTT
GTAACGTAAGAGGTTGTTTGAAGTATTAATCATGAACTGTCGAAAATGAGGAATGTTGAAAAAAATGTGAATGATCAGAGAAGAACCTAAAATGAGATAAAAATGGTGAGAAAGAAGACT
GAACTAAAAACTATTGGTAGGAAATGAGTCGTTTAATATCACAATACATTGTATTATAATAATCTCATAGAAACACCCCTAATCGTTAATATTTTGGTAACAGGAGATGATTTAAGTAAA
TTTAGCAACAGAGATAATAATTGGAGATGAATAAATTTATAGTTTGTTTTGATTTTACTATGTTTAAAAATATGTAAATATTAAAAAGTACCTGAATGATGCGACGGAGGGGACGTTGGG
GGCCTTTGGCAGCATGGGTGCCGAGCCAGGGAGTGTGACGCCAGACAGTATTGCCGTCGCTGCCGGCCACCACCTTACTACCTCCAACGACCAATTCAAGTGACCACATAGCTGGTAGCA
TTTGCCAAAGAACAAAGCAGCCAGTGTCCTCACATCTTGTTCCAACCGTCTTCACAGATTTACCAGAAGAAACCTCTGTTTCGCAACGAATCATCTTCACACTTCCGGTGGCGTACATGT
TCTTGGCGCACTTTTGCTGTTTCAGACATCCCGTGGCGGCCAAGTATTGTTGTATAATGTAATGAGGCACGGAAGTTTCAAGAGGAATATGAGGCGGGAAGTAGGAGGTTTGTGGAGGGG
AATTATTGGAATGGAGAGGAATGGGAGCGAGAGGACATGCGAGGACGCCGAGCAAGAGCTTTAAATCCTGGGTTTTGGAGTTAGGAAGGTTTGTGAAGGAAGACTGGGAGATGGAGGGGG
TGAGGTTGCGTTGGATCTTAAACCAGTCGCGGAGGAATTCCCAGTTCGAACCGGAGGAGTCTTTTTTGTTGGGTTCTTGGTCTTGGAATTGGGGATCTGGGCCTTCCATTAATGGAGTCA
AAGGCTGTGAGTACCAAATTTGTTTCGATCTCCTCGACTTTNNNNNNNNNNNNNNNNNNNNNNNTCCCCCGTTCCCAATCTCAACCGCCGTCGCCATTCCACCTTTAATTACCTCGCCTT
CAACCAGATATAATTTCACACAAACTTACCAATCAATTAAGCTTCAAAACTGAGTCGATTACCAACGTGTTTTAGTAACATTATTGCTGCTGACACCGACCAGGAAATAAAGATTTCAGT
TGATTTGGACGGTTTTGTACTGAAAAAAAGAAGATCCAGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGGGACTATGAAGTGTGAAAGTCTCACAGTGGGTGGTGGC
CGGAGTTAAGGAGAATGTGAGAGAAGGAAAGATGAAGATGAGAGGATGAAGGAGATGAAAGTATAAAAGAGAAGATTGGGAAAAGACAAAGGTGGGAGAGTGTGATTATAAATATTAAAT
GGAAACTGAAATCATTACTTTCCTTATCGTATTTTAATCCAAAACGCATGCATGCCTTCGAGCGTTTTTTTAAAAGAATATTTTTACTCTCAAATTCATTTTGTTTCCAAATATAATTAT
ATTTACTTTTACGATTGAGTGAAGCTTTTACATCTATCTCATTTAAATCTAAAAACAAATTACTCATTTCAAATATGGAAACCCAATGCATGNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNCTCATAAATTACGAAATAAAGTTGAGTAGTTTATTAGCTTGAGTGGATAAGGCTATTAAAATTTAAATAGTTCTTTTATATATACATTAAGTCTCTCAACCCTTTTCCCCTATACC
AAATTGTTATGAACGGAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAGTTTTTAGGTTA
ATAAGTGATGATTCGAAAGATTTTAATCTAATTTTGTTTTGTTGAGTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
TCAATTTACTTTTTCACTTTTTACGTATTACGATTTTGTTTTCGTTTCGAGTTCGATTACTCACATTTTTCAGTACGTTGAATAATCAAGACGTTACATTTGAGTCGTAGGAGAGGATGG
AGAATTTGAAAAGGAAAGAAGATGAGAGAACATATAGATATTATATTATAAGAGATTGTTAGCAAAAACAAAAAGTATGTAGAAAATGTTGAGATTAGAGAGGCGATTGGAAAACGAAAA
AGATGAGGGGAGAGAGAAAAGGGAAAATGTATAGTAAAGTCTTGAGATGAGAGAGGAACAATTGGGAATGAAAAAAGTTAGAGAGGGAGAAAAATAACAAATAAAATCATTGCTTTCTTG
AATTCAAAGGGTGCATTCAATAAAATACAAATTTGAAAGGGAGAGTGTGGAAACCATATCTATAATACTCTATAATATATTAAAACGTGTGAACGTAGTGATCATCCGATAATATGAATC
NNNNNNNNNNNNNNNNNNNNNNNGTATCAAAATAAACATAAATAGCAGTTTATCATAATCTATCACGTATAGACTGTAAATAGCTGTAGAAGATTTTGTCATTTGAATTAAGTTTTCTAA
TAGATATATGATTAAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT
CTACCTCGTACCATTACCACTCGTAGTAAATTATCTTTAACATTTTATTATTCTCTCAATTTGTTAAACTCAAAGCGTTTTCAATTTTCGAAGCATCTAAAGTAGGTGTTAAATTCAAGT
CGAGACACTAACGAGTCGAATTCAAGATTTCAAATTCTCTCTATATATGTATTGTTATTTTACCCAAAGATGTTTGATGGAAAAATAAAAGTTTTCAATCATTTACAAGCTTAATTATGT
TAGTTTTGTTGAAGTAAAAAATCTATGTAACCCCATGCTTTACATTCCATTTTATCAATCATATAGATAGCATACTAACTAATAATGTTAAGCAATTTAGCTATATCACATTATGGTATT
TGGACATGCATAACAAAAACTCAAGTAGACCCTAAATCATAAATCAATTAGAAGTTAAGGTTTTGAGAAATTCTTGACGAGTAATTGACTTGAATCATACTAACAGAGTTGACTTACAAA
ACCCTAAACCCTAAACGACACATAAATCTACTAACCTTTAGTGAGCTTGCAAAATATAGAAAAACTTTTAGATTTAAGCACTTATAAACACGAATAGACATTTATAGAATTCGATAAATA
TTTGACAACTCAAGAAAAGTCGAACTCAATCGGACCCAAACAGATGGAAACGAAAGTAATAAGTTGGATAAGAAGATACTAAAAAAGAAAAGCTATATAAGAAGTGTATTTTTGTAATAA
ATGATTGAAAAGAAAAATGGGAAGAAGTTGCATTGTGTGATTGTGTGGCAAAGGCAGCAAAATAGCAAACCTTCTGGGGGACATTTATAATTTCGTTAAACTTCATTTCTTCAAGAGCAA
AGAAATAATGGAGGCGGCAATCGGCCGTCATTGCGTACTTGCCCCGCGAAAATTCCATTCGGATTTCTCCCATTGCGCCGTTCTATAGAGTTTCAATCCATTTCCTACTTCTCTTCTCAA
TAGTGAATACATCCCTTCCATGGCCGACTCTAGCCTGCCTTCTCCAAGAAGAGATTCTATCAAGTCTTCGGGTGCGTTCTTTTTTGAGGAATTCATTGCAGTATTTGATTTCGGATTGAT
TTCTTGCTGCTATGTGTTCGAGTTTGAGGATTATTGTTGACGCTGTTCGCCGATGACTGAAATTGGTGCAGCTGCGTTCGACATGTTAGTTTGTTTTTTGGATGCTTAGTGACGAAAGAG
GAGATTGGAACTTAATTTGCGTCTGATTTTTAAAGAACGTGTTTGTTTAATTTGATTGGTATTTTGGGTGAATGGAGTTTTTTTGCTATTTGTTGTAGGAGATGGATGTTCCTATTTTTC
TGTTGATTTTTATGAACTTTGTTCGTAACTAATGCAGTGAGTGTATCTGTATTTCTGTTCTCAGTTGGGAGTGTTGCTGCTAATCGAAGACGACAGCATGCGATTGCGGTGGGAAAGGAA
AGAAGGGACTTGTTGGTGCGCGCGAAGCGCTTCTGCAGAATTGGGATTGGTGATGCTGATGCTGTTGACAATGAAATGATAATGGACGAAGAGTTGTCGATTTTGGAAGTTCAAACTTCT
TCAGCAGTGGACGAGCTAAAATCCGCAGTTGCATACCAGTACGTTGATCATTTTTCTTTCTCTTATCCTCAGATTAACGGAAAAGACATTTCTTCTTAGTTTTCGTATCTAAAAATCACA
TTTTGGTTACTTGTTAATTACCTTAACTATCCCGTAGAAGAAACTGCTGTAGGACGAAGAGTTTGAGAGATATGTGCTATCAAGTTGTTTCTTTTCGCGGACCCACTTGGTGCTGTGGAG
TCGTGTAACTTACTATCTAGTATGCGTGCTTACTCTAACTAGTTTAAGGGTTCTAATTTTGCACACGTTCATGCTCTCAAGAAATCAAGCAAAATCACTATCTAGATTGCCTGAAAGTTG
TCGTTTTTAAAAACAAATAATGAAGTATCCGTAAGATCCATCGAAGCTGATGGTGTCGTTTCATTTCTCAAACTTGAAATGTGCACCAAGGTGGGAATTGAGAAATCATTCCTAATCGTT
GCTGGAATCACAATTATAGGAGGAATGAACTGAATTGTGAAAAGGATATCAAGTATTGTCTTAAAAAATTTCTTAAAAGAGCTACTGTTGTTTTTTTTGGGGGAATGAAACATTTTATTG
ATTGAATGAAATAGGGGCCAAGGCCCGGGCACCCAAAGGTGATCATATGTCAATAGGTTTTCTCCTCCAAACCCAAATATTGTCCCATAAGCTGTCAAAGATTTGGATTAGAAAAGATTG
GTTTTGAAAAATCATTGATGTATTTTAAAATGGACAGACTTGGGCACCGTTTTCTGCATTTTGTTTTAGGTGAGAGGGACATGGTTTGACCCTATGGTGAACAATAAGGCAGTAAGTTAC
AAACATTTCTTTAACTTCATTTATAGTTTTTAAATGAGCCATTCTCCACCGTATTTGATTGGTATATTGAACAATTGATATAATTGGTGTAAAGGTCTTGCTGTTTCTATTGTAGGGGAA
AAGGTGCAATGCAGAAGAGAATTCATGCCCTTCGAGAACTAAGACGCTTGTTATCTCGATCTGAATTCCCTCCAGTTGAAACTGCTCTTAAAGCAGGAGCAGTATCCTTGTTGGTGCAGT
GTCTTTCATTTGGCTCCCCTGATGAACAGGTAAAAAATAGCTTGCCTGAGAATGCGCTTTGATTGATTTGAGTTATGTGCATTATAGGTCCAACTGCATTACACAAATGCAGGGTGCACT
TTTCTCACAAGGCTATGGCCAATCATGCTGAGTTAAAAGGGAAATGGAATAAGTGACTTTTTTCTTCTTGTAGCTTGTAGGTGCTTATTGTTGCTTGATGGCTTTCAGGAACGTGATTAG
ATATTTGATGACTGTTGAACTTATACGGGCAATTCAAATATTTATTTTTTTGTTTTGAAGTCTTTGCTTCTATTCCTTTGCTGCAGTTGCTTGAGGCGGCTTGGTGCTTAACGAACATTG
GAGCTGGGAAGCCTGAAGAAACCAAATCTTTGTTGCCAGCAATACCGTTGCTTATTGCTCATCTTGGAGGTTCACATTACCTTTTAAATTTTATTTTTCCTTTCTCTTACGAAGGCTTGA
TACCTGAAATACCATATATAAGTCCAAATTATGGTTTTCAAGTTAAGCCCTTTATTTGATTCACTTTATTCTTCCTCTTCCAATTTCATGCCAACAGTCTGTTGTCATCATTATGTATGA
TTATTAACACTCCTGTGATATGCATATGATCACTGCTTGGCCAGCTGTAACTGGTAGACTTTGTCTGAACTGTCCTGTGTAGTTAAAAATAGTTGAGGCAGTTTCTTTAAATTTGAATAT
TTACAATGCATGAATTGGCTCATTCATTTGGGAAAAGAAACAGATTGGGATGTATTAGAGACTTCAAATGTGTTATTTGTCCATGAACTTCCTGGAAGCTGTCACAATTTATTTTAGTAA
AATTTTAGATGAAGTCTTCTCTTTCTCTGTATTGGTTTTTATTTTTGTTTTGACTTGCATAATTCTGTGCAGAAAGAAGTTCACTGCTTGTTGCAGAGCAGTGTGCATGGGCATTGGGAA
ATGTTGCTGGTGAAGAGAAGGAGTTGAGGAATATTCTGCTTTCGCAAGGTGCTTTATTACCTCTTGCCAGAATGCTGCTACCAAACAAAGGTTCATCCGTTAAAACAGCTGCTTGGGCAC
TATCCAACTTAATTAAGGTTTGGGGTTTTCTTTTACTAGCATAACATACCTTCTCCTATCAACAACTACATGATGTCATACTGTACAGAGCATAGCTCAAATCACAAAATTTGAAAGATT
TGTGCATTTTGTTCACAAAAGAGTACCTCTCGTGTTTTTCTCATGTAGGGACCAGATTCCAGGGCTGCTACAGAACTAATTAGAATCGATGGGGTGTTGGATGCCATCATTAGACACTTA
AGAAAAGCGTAAGTATAGTTATCAAACTTTGGAATTCATGTTTTGATCATAAAGGAGTTAATACAATGATAGTCGGTAGATATGTCCCTTATTCTTATCCAGATTTCTTTTTTCTCATTC
TCATTAAGCTGTTTCTGTACAAGTTGATTCCGTATATTATTGGGTTATCTACTGTTCCAGATGATAGTTATACCTAACCTAGGCAGAGATTAGATTTAGCACAATGCAAATTCTCTTTGC
AGCTTTTGAGCATTATAATTGTGGAGCTCGCGAGAAAATTTCCTGTTGTGATTTTACATCTACATTGTTAATACTGTTACTATTTTGAAGAGGAAATTTTCTATGATTGTATAGGTGGAC
AGGGTTTTAATTATATTCAAAATTACGAAGTGCAGGGATGATGAGTTGGCAACTGAAGTTGCCTGGGTAATTGTGTATCTCTCAGCACTCTCAGATGTTGCTATCAGTATATTGGTGAAG
AGTGAAGTTGTCCAACTACTTGTGGAAAGATTATCAACATCAAATAGTTTGCAATTGCTTATTCCGGTAATGTTAAAGTAAAACAATGTCTGCATTCTAAGATTCACTTTTCTGAGTTCG
GTCTAATGTACAGTAAATTATCGTGAGATGCCTAGCGTACCTTGATGAAGATGTTAAGTCCTTTTGTTCTTCAATGGCTGTCTTTAGTTGTCCACGACTTCCCTTTCCATCTTTCTTACC
TGATTAATTATGAATTTATGCTTGTAATTGTGACACCATTATCAAGTCATGCTTTGTATCAATGTACGTTTTCTCCAAGTAATAAATTTGCATCCATTTTCCTTATGTTTGGTTCTTCTG
TAGCATAGAAAGATCAGGAAGACCTAGTTAATTGAGTGAGGAGAGCTTTTTAAATGATTCCACATGTTTCGTGTTACAACTACTTGAAGAATGCCGTCTTATGATCTCCTGTTTTGCACA
TTATTTTGAATGCCAAGCACATTATTTTGAATTTGAATTGCTCATAATTTTCAGATCCACTAGCTAGTGTCCATGTTAGCATTGCCTGATACTTGGAAATTTTATGAATATCAAGCAATT
CAATGGTTTTTTTTATCAACTACATTGTGGGTTTTTGATAATTCAAAAAATTACATCTTAAATAGGTGCTTCGAAGTTTAGGAAACCTTGTGGCAGTGGATTCACATACAATTTCTGCTA
TTCTCATTCCTGGAAGTGAAATTACAGGTGGGCAATGTACTTTTTTTCTCTTGCTAGGATGAAATCGCGGTAGATTGATTTCAATGAATATCAAAGGAAAATAATCACAGTGATTTGTGA
GATTTGAATGGAATATGCAATTCTGTTGTTTTCAGGTAGTGTTTTAGAAGTCCTGATAAAATGCTTAAAAAGCGAGCACCGAGTTTTAAAGAAGGTAATTTTCATTACTTGTTAAAATAT
TACCATCTCTGAATAGATTTGGACTGTGAGTTTATTATCTGAATCCCTATCGAAAGTAGGAGGCATCTTGGGTGCTGTCTAACATTGCTGCGGGTTCCATGGAGCACAAGCAATTGATAT
ACACCAGTGATGTGGTACCCTTGTTGATTAGACTTCTTTCATCAGCACCATTTGATGTAAGAAAGGAAGTAGCATACGTATTGGGAAATCTCTGTGTTGCGCCTAATGATAGTGACGGAA
AAGCAAAACTTCTAGTTGAAAACTTGGTTTCACTTGTTGGCAGAGGATGCCTTGTGGGTTTCATTGACTTGGTAAGATCTGCCGATACAGAGGCTGCAAGGCTAGGATTTCAATTCTTGG
AGATGGTTAGTATATCTGATTGTTCATATGCATTGTTTCTATTGTTATTCTTCTCGTTTGTTATTTTTCCATTCGGGGGTTTTGCTGAGTTAGAAAGCATCTCTTTTTTCTTTTGCTTAA
CTGAATCCTCAAGTCACCTCATTCTCCATGTTGACCACCTACTTAGGGACAGCAGAAATGATGGCTGGGAAACAATTGGAGGCCCCTCATGGCCTGTCTTGGATTAACAGATTATAGAGC
TAATTTATAATGTTCTTAAGCTTTTCTATCATTGCCGCACTTCAATTTATATGTATATATACACAAGTTGTTAGCTCTGCCCTTGCGAGGACTACTTATGTGTTGCTTCCTTGAGAAAAC
GTTCATATCATATTACAGACTTTTTGGGAGGACGTATTTCTTATTGTTCTCTTACTTCAGAGAGTTGGTGACATCCTGTGATATTTTGATGTTCAGGAGGACTTCCGAAAAAAATTTGTT
CTAATCCATAATGATAATGCATTTTCTTGTTCTTTGGCCAAAGGTATTGCGAGGAATGCCAAACAGGGAGGGTCCCAGGCTCGTTGAGCGGGAGGACGGGATTGAAGCAATGGAAAGATT
CCAGTTTCATGAAAATGAAGAGTTGAGAAACATGGCAAATTGTCTGGTCGATAAGTATTTTGGCGAAGACTATGGTCTCGACGAGTAGACAGTTGAGGCTTTCAAGACTTAAGCTCTCAC
AGTTTTCACCATCAAAATTTCATAGCTCTGTCTGCGGTGCACTCAAGTTTACTAGCTGCTTTATGAAATCCAGCATCCTTGGAGGAAGGTAGAATCGAGCTTTCGGTATTATCTTTGTTT
ATTTGCAACTTTCCTGATGAGTTTGATCAGAGCCTGTCTTACTTTTGCTGTAAAATCTCGTACACGTCTTTACTATAAGGAAAATGCATTGCAAAATTTGGATAAATGACCTGAGATTTT
GAAACCCCTTGTCATCTATTGAACTATTCTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAATAAGTTGGTTGTGGGTTTTGTTATTGTTTTTACAGCTTTAATGGTGAC
TCCACATAGATAAATACAATCTGGCCCTGTTGGAGAGTTGTATGTAAAATTTGAAATTTAGATTCATAGATGGAGCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTGTCTAAGAATTTTCCTTTTGAAAGGACCAAATTTTGAGTTAAAATCTAGTT
TTTAAAGAAGATTCTAAAGTGACATCCAAAATGATTGATGTACATAAAAATAGAACAGTTTGACAATTTGGTGCTAAAATAGAACAGTTTGACAATTTGGTGCATAGCGTTGGTGTAGAT
TTCAACCAAAAGTTGTAAAAATAGTTAAATGAACTCGTCGATCTTAGATCATAAGCTTGAATCTTCTCAAACGTTAAGGACTAGTATTTTTATTTAGAAACACACAATTGTTCTCAGTTC
CAACTTTAAGGACTGATGTTTTCCTTCAAGTTAGAAGGGATTTCTGCCATCTTAATCTTAGATGTCTTTTTCAGACTTTTCAAATAGCCCTAAGGTAGTTGATATAAAACTGTCTCTCAT
TTCAATTTATTTGCAAATTATTATGCATGGCCTCAGTGAACTTTCATACAACAATAACTTAGAGAGGTGATGGCTTGGCCTCTAAAGTTGACTTTGAAGGGCAATTTCATCCTTCATCTG
TTTCCTCAAAACTCTTCTCAGTAACTTATTAGAAGCAGTTCGTGGAAAGCTTGGAACAATTTTCACAAACCCAACCTGCAGTTTCATTCATTTCAAAGTTCAGATTTTCACGACCCTTGT
TTGCAGAAAACTGGAAAGAAAATTAACTTTGAATGAAATGCTACCTTGAACAAAGGGTTCAGATTGCTCTGGATTGCTTTTGAAAATTTGATTTTCAGTTCTTGTGGGGACTTTTTATAT
CCTTCTCTAAGTACGACCAAAATGACTAGTTGTTCTGGACCTCCTTGTATAGGTGACACAGCGACCGCAGCGGTTTCCAATAAACTCTCATCAACATGGTCGCATATGCGTTCAAGTTCA
ACCGAACTTGTCTACATTTGTGTGAGAGAAGCAGGTGTTAAATAATTTAACAGTTGGGAAGAAGCTTATATGTGGTCTTTAACAAAGGAAAAAACAAGTGATAAGGTTGCTCGAACTGGC
TACTTACTTGACTTCTATAAAGTACTTAGTTATGGATATTATTAAAGCGCACAAGGGTCATTTGATAGGGACTTAGTTGGGGTATCTTGTTATAAATAGNNNNNNNNNNNNNNNNNNNNN
TAAGAGTGAAGAAGGGGGAGTGATCTAGGGGTTGGGTTATCATGTACTTCTTCTATATTTCAATATATTTTAGATCTTATTCTAATTAGGAGGTATCCCAACAACTTCACAAGTCTCGAT
TTTTACAGGAAAAATGTCATTTGTGTTAGGAGTAGCAGAAAAAACAGTGTAGTACCTTGATGCCGCCAAGGTTCATGGTGTCATCAGCCCTACCTTGAACAACTAAGTAGCCTCCAACAG
TTCTTTTGATGATGTCTCCATGTCTCCTCAGTTGCTGAAATGAAGTGAATCAAGTAAAAAAATATTATAAATGCCTGCCTGCTTATTTTAAAAAAATGAGATCTCCCTTGCCAGTTGGAT
TCATAATCAACCAATACTTTAACCCATATTCATTTGGACGCCGGAACAGAGCATAAATACAGGCAAGTTTTGTACCAAAAGTCCCTGGGAAATTAAAAGAAATCTAAAACAAAAAGAAGG
GTGTGCTTGAGCTTGACTGTACCATTCCATTGTATATTGGCATTCCCTTGAAGTACACTTCATCATGATCAGCATTTAGCAGTTCGCTACTAGCTCCGAGATATGTAGGGAATAACCCTA
TTTCACCAATGCAAGGCTGATCATCTGGCTGTTTATCAAAAGAAAACAGATAAAATAAAATGCTTAATTTTTCATCCAGAAATTCACTTAATGACGTAAAATCCTATTCATTGCACTCAC
AGAAGGTATTCCATGTTCATCAAGGATGACAAATCCTGTGGTCATAGATGCAGTGCTAAAAGCCCCAAAAGCCTGTGGTTGTACTGGACTTCCGACGATGAAGCTTGAGCCAAGTTCTGT
GCCACCACAACATTCGAACAAGGGTTTGTAATATGACCTTGAGGAGAGCCAGAGATCATCATCGACATTTGACGTTTCGCCGGTGGAGGCAAAGTACCTACAGATATCAACTTCTAAGTC
CATTAAACTAATTTATATATTTAAATACATATTAGTAAAGAAGATTTATTTGGATCCCAGACCTCTTTATTCGTCATCATACATCCCATTCGAGTTGAGCTAGGTTTGTAAAATATTACC
TTATCTTTGTCCAATTTAAGCCTTCCATGCACCTTGTATCCTTCCAAGTTTTTACCAAGCTTGGAACTGTTCCCAACATAGTCACTCCTGCATCCTACAACAAATGTAGAGGAAAGAGAT
GCTTAAAATCTAAAACTAGTTGGCCTAGCAATTAAATCCCATGGTTGGGCTCATAGGCATCTGACAAAACTTTCACCTGAACGAACTTTCCAAATCCATAGCCAAGAGGAGATCCATGAT
AGAGAGCAAGAGTTGCACCAGTTAACAAGGCTGAGTACACTGAAACTGGCCCCATCGCCCATCCTAAATTTGTGGGCCAACAGAAAACATCACCAGGCTGAACATCCATGTGAGCCCAGG
AATCAGCAGCGCAGCGGATAGGTGAACGTTGTGTCCATGGGATTGCTTTCGGCTCTCCTGATATGAGCCACAAGTTTATAAGAATTTGCAACTGCCGATGTCAAAATATCATATTAACAC
ATTTTCTTAATCAAATACACTGTACTACATACGGTCAGTGGCAGTTTCAGCTAAGGAGCCCCCCTCAAATCTTTATCCGTGAGGTAATATTAATTAGTTAATTGGATTATTCAACAAAAT
GTGTTCTTGCCATTGCGCGGTTGTCCTTTCTTTATAAAATTGTTAAAATACTATTTTGGTTTCAAAAATACATCCTCAAAGATTTAGCAAAAGTTCTCGGTCTATAAACTAAAACTATTG
AATAGAATGATAATATTTGAGTCTAAGTTTGCATAAATCTTATTAGCCTCCAAACGCTTTCTAAATTTGAAGTTAAGTCCTTTCTGAACAAAATTTTTGGATCTGCCACTGTACTTTTGC
CATGTGATGTGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGGCTTATTAGGTACTAGAAGAGAGATTTTACCCGTAGTCCCAGATGAAAAGAGA
ATGTTAGTCATGGCATCTATTGAATGATACATTGGAGAGTAACAATTTGATCTGCAATATAACAATGCTTCCATCAGCAGTTCAAATTTTACTGATTCGTACATTGTAAACTATAATCAG
TACAGTAGGCAATCTTTGTAACATTACCTTCATCAGCAGCAGAATTTAAGTGGAACATTGTTTAGTGAACTTACAAGACGGTAAGAAGAAAGCAACGAAGTGTTGACATTGTCTTTGCAT
TACCTTGGAAATTCCTTTGCAGTTGAAATAAATTCTTCCCATGATAGATCCTGTTCTCGCAAATCCACTTCCAGCCTGTTTCCACTTGCGGGAATCACTATAGCCTTACACGATCCCCCT
TCTATAACCCGACTGCAAGGAGAAAAAAATTCTGTGAGAAAGTTCAATGTAGCTATGTGTTCTTCCAGAACTAAATCTATGCGTCAAATGGTAATATTAGCACGAGAGCTTCCAAGAAAC
CTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTAATTCCTACGACGAAACGAAAGATCAATCAATCTATGG
ATTAATTAATAGTGTCATCCCATCTAGAAATATGTAAGTTTGCTTCTAACTCATGACACTCTCATTCCCTAAAGACGGTAGGAAAACGTAGGGTTTTCTGTTGGTCACTTCACCTGTATA
AGGGATACTTCTTGCCTCCCCTCAATATGAAATCCTGATTTAAATATGAAACAAGAATTAAACATTGAAGAACACTGAAAACAAAGTCAAATGTACAAATTAATGATATTTGAAAACAGA
TAACACAAATTCTGTCATTTTGTGAGATGATATTATCACCAAATAAGAATCAAATTCTGTATATTTTCCCGTTCTTCACCTTGAAAACAAATAAACGAAGAACCTAACAGAATGCAATCT
TCAGTTTTCAAATTCACATCAAGACTCGTTTAAATTCATCAGAAAGGAAATTCAGCGACAATATAATGATCTCTTTGGAGAAATGACTACCTGATAAGATGAGATTCCTTACCTACCTCT
AGTTTCAAAACTTTTTAACAAAATTACCTGAGTAAAGATTCCCTTTGCTTTTGATATAAGCAGACGAACTGCAACTTCATTAGCAGCAAAGCTGTCAGCAATAGACACAACAACAAGCCC
TGCTAGAACAATAGCTAAATATATAACAACTGCATCAACTGTCAATGGCATGTCAATAGCAACAACATCGCCCTTTGAAAATGTTGCATCGAGTGCATTTGCCACCAACCTGCGCAACAT
GCCAAGATCTTGTTAAAACTAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCTATTTATAAAGAAAACGTGAGATAATTATAAACCGCTTTTCAAGATAATCGCTT
AATACTAAACCTCTCCTCTGATTAGAATCAGCAATATTTATGATATATTTGATGAAACGTCGGTATTCAAAGAGAGGAGCATACGTTACTTTCTCTCGAAGTTGTTTGAGTGTCATGTGG
TTCACGTTTGAATTATCACAGCCTTCATCCCTCCACACAATTGCCAAAGAATTATCATCTCTCAATAGGCGACTTGAAGAACGCAAACAACACTCAGCAATATTCAACATGGAGTCAGGG
AGCCATCTTCCATTTGGCTTCTCAGTCCTATCTAAAATACACCTCGGTGCTTTTTGAAAAGTAATAGAAAGCTCTTGAAGAACAATTGACCAGTAAATCTATAACCATCAAAGCACAAGA
CAGTGATCACCAAAATGTATACAATTTCCATACTAAAACCCCATGTACAAAATTGAATCCAAACCTCAGGATTCTGAATGGAGAATTTCTGAAATAAGCTGAAACTTGATATAGGATCTT
TATATGAAGCTCCCAACAGCTTTGGACCATGCAACTCCATGATCTTTCCCAAGTTTGTCAGTTTAGATTGATCACTACAAGTAGAAATATGACAATAGGCATTACAAAGACAGAAACTCT
ATAAAAATTAGGTGAATGAAATGAGAAACATTACATAGAAGGAAACCAATATGGAGGAGGTCCATTGGAAGAGATATTCCAATTAGCATAAACAGAGTAATAGAGAAGGCGATGCAACTC
ATATGGGTGTGTGGGTTTCAAGGCTCTTCGAGCCATGAGCTCCCGCCAAACCTCAGTAGGCTTTGATCTTTGGGCTGTGGACAGTACATTCTGAAGAATCCTATTGAATTCCACAGCTTC
ATGGAGCTTTAAGCCTGTTTTCACTAAATCTTCAATACCCAATTCCCAAATGCTCTTTCCCATTTTGTGTTTCCCTTCGAGATCAAAATTCCATTGGGGCATTACTAAAATGGAGTTTGA
AACAGGTTCCATTTAACGTTGTTTCTGAAGTCACAACCTATGATTTGATTTTAAGGATGTGACAATTAACAAATTGATGCATCATCCGTGTGCCCTCAAATACATATATTTAAGTTATCC
ACGTGCATTGGTAATGATCATTCACTCAAATTTATATATATTCTTTCAAAGAAGAAATAAAGAAAGAATTTTATTGCATAATAAATTATCATTAAATAGTTGGATGGAATACACAAAATG
TACATGTTCAAGGTCAGCCAAACATTTTATTAGTAGGACAATCATCAAAATTTATGATTTCTTAAAACTCAAACTAAAAAACGATTCACCTAAGCATTTTTCTAATATAACAATCTTCAA
AATTTACTATTTTTTTTCTTTTCTAATAAAACATGGCTCCACAAATTAAAATGTGTTGTTTAAAAGATCACATGTTGAAATACATTTATATTGCAATCCTTTCACTCTTAATCATTGGTT
TTCTCATCTTCTATTTCCTATAAAGCAAACGCACTGAGTTCGTTTGAAAGTACACATCATTACAAATTAATAGTAATACGACGTTGGCAGCAACAACTGGATTCAGTATTGACTTACTCT
TGTCTTTTTTACACAATAGTTAAGGTGGTTGTGAATTTAAGTTATTGTTTCTGCAGCTTTGATGGTGATTCCATATAGAAAAATACAATCCTGCTATGTTGGAAACTTGTATATAAGATT
TGAAATTAGATTTGCGAATCCGAATGATTTGATTTCTAGAGTTTTATATGAAAGGTGCTAATTATCTATTTAAACATATGTTTCGAGACACAAGCAACTATAAATTATTGAAAGGTCATA
AATTAGATTTATTTTCTTCCAATTAAACACCTATATTAAATTACTTTTCAAGCAGCTTTATGGAACTGCTATTAACTATCTTATTTCAATAATTTAGAGAGATTTCGTCTTGGTCTCTAA
AGTTGACTTCGAAGGGCAAGTTCATCCTTCATCTGTTTCCTCAAAACTCTTCTCAGTAACTTGTTAGAAGCAGTTCGTGGAAAGCTTGGTACAATTTTCACAAACCCAACCTGCAGTTTC
ATTCACTTCAAAGTTCAAATCATCGAAGGACCTTGTTTGCCAAAAAAATTGGAAAGAAAATGTCAAATGCTACCTTGAATAAAGGGTTAAGATTTTTCTGAATTGCTTTTGAGAATTTGA
CTTTCAGCTCTTGTGGGGACCTTTCATATTCCTTTCTTAGTACCACCAGAATAACTAGTTGTTCCGGACCACCTTCTATAGGTGATAGACTTACTGCAGCTGTTTCCAATATACTCTCAT
CGACATGGTCGCATATCCGTTCAATTTCTACCGAACTTGTCTACATGTGTGTAAAAGAAGTAGGTGTTAAATAATCTAACAGTCAGGAAGAAATTTGTCTGTCTTTTAACGGAGGAAAAA
GCAAGTAATAAGGTTGCTCGAACTGGCTACCTACTTTGTCAAGAATGTGGAGCCCAAACTTATTGGCTCAAAATCAATTTACTCAAGTCTTGAGCAAATTTTTTTGCGGATAAAATTTTT
CTTTCTCAACATACATGTGGAAACATCTTATTTTCATGTTAACCCATTTTTTTCTCAAAGCCCATTTCCTCTAATGAACTTGGGTAAGAAAGCTTTTTAACCGGCTAAAATTGTAGGTGG
TTATGATTAAAGAAAGAAATGGGCGGTGGAGTTTATTCTATAGAAGGAGGAGGCTTTTGAAGGAAAAAAAGAAGTGTGGGCCGTGATTCACTTTGCCGTCGAAGATGAATTAGAACTGAG
AGCATTAATGTTTTTGTTCTTCAGTATTTTGGAGTGACAGCACAGTGTGCATTTTTCTATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGTACTTGACTTCTATAAAGTGCTTAGTTAGGAATATTAGTAAAGAGCTTAAGAGTAATTAGATAGAGT
TAGTTAGTGTATTTTGTTATACACAGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAACTTCACAAGTCTATCGATTTTTACAGGAAAAATGTCATTTGTGTTAGGAGTAGCAGAAAAAACAGTGTGTAGTAC
CTTGATGCCGCCAAGGTTCATGGTGTCATCAGCCCTACCTTGAACAACGAAGTAGCCTCCAACAGTTCTTTTGATGATGTCTCCATGTCTTCTCAGTTGCTGAAATGAAGTGAATCAAGT
AAAAAGATATTCTAAATACCTGCTTACTTATTTTAAAAAATGAGATTTCACTTGCAAGTTGCATTCATAATCAACCAATACTATAACCCACATTCATTTGGATGCCGAAACAGAGCATAA
ATACACAGCCACGTTTTGTACCAAAAGTCCCTGAGAGATTAAAAGAAATCTATAAACAAAAAGAAGGGTGTGCTTGAGCTTGACTATACCATTCCATTGTATATTGGCATTCCCTTGAAG
TAAACTTTATCATGATCAGCGTTTAGCAATTCGTTGCTAGCTCCCAAATATATAGGGAATAACCCTATTTCACCAATGCAAGGTTGATCTTCTGGCTGTTGATAAAAAAAAAAAAGCACA
GAAAAAATAAAATACTTGATTTTTCATTGAGAAATTTACTAAATGACATAAATGCCTATTTCTTGTACGCACATAAGGTATTCCATGTTCATCAAGGATGACAAATTCTGTAGTCATAGA
TGCTGTGGTAAAAGCCCCAAAAGCTTGGGGTTGTAGTGGAGTTCCGTTGATGTAGCTTGAGGCAAGTTCTGTGCCACCACAAAATTCAAATATAGGTTTGTAATATGATCTCGAGGAAAG
CCAGAGATCATCATCGACATTTGATGTTTCGCCAGTAGAGGCAAAGTGCCTGCAGATATCAACTTCCAAGTTCATTCAACTAATAAATATANNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGACACCATTAAACTGACATTAAATGTCATAACTTAACATTCCAATATAGAATTGTAAAAT
ATTACCTTATTTTTGTCCAATTTAAGCCTTCCATGCACCTTGTATCCTTCCAAGTTTTTACCAAGCTTGGAACTGTTCCCAATAAAGTCACTCCTGCATCCTACAACAAATGAAGAGGAA
AGAAATGTTTAAAATTTTAAACTAGTTGTCCTAGCAATTAAATTCCATGGTTGGGCTCATAGGCATCTAACAAAACTTTCACCTGAACGAACTTTCCAAATCCATGGCCAAGAGGAGATC
CATGATAGAGAGCAAGAGTTGCACCAGCTAACAAGGATGAGTACACTGAAACTGGCCCCATCACCCATCCTAAATTTGTGGGCCAACAGAAAACATCACCAGGCTGAACATCCATGTGAG
CCCAGGAATCAGCAGCGCAGCGGATAGGTGAAAGTTGTGTCCATGGGATTGCTTTTGGCTCTCCTGATATGGGCCACAAGTTTATAAGAATTTGCAACTGCGGATGTCAAAATATTGTAC
ACATTTTCTTCATCAATAAACATATGGTCAGTAGGGGTTTCAGCTAAGGAGCCCCCGTCAAATATTTATCGGCGAAGTAATATTAATTGGTGAAATGGATTATTCAACAAAAAAATGTTC
TTGCCATAGTGGTTGCCATCCCAGGTTCAAGGTCCTACCCACCCCATATTTTTGCGTTGCTTCTCTACATTTCTATACTAAAAAATTGTTAAAGTACTATTTTGGTTCCCACTTTGAAAG
AAGTACATCCTCAAAGATTTATCAATAGTTCTGGGTCTAAAAACTAAAATTATTGATTAGAATGGCGATGTTCGAGTCCAGGTTTGCATAATATAATTGCAAAAGAACCTTATTAGCCTC
CATACTCTTTCTAAATTGAAGTCAAAGCCCCTCGGAACAAAATTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGACTAAGAAGCACATATATGATATGACACAAAAACAGAGACACAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGT
GCTTGGAGAGAGTAACGATGCAGATGTAGTTCTTAAAAATTGTTTTTACCTGTGGTCCCAGATGAAAAGAGAATATTTGTCACGCAGTCACTTGAATGATATACTGGAGAGTAACGATTT
GATCTGCAGTATAACAATGCAGATCAAATTTTACTGATTCATTCATAATAAAACATAATCAGCACTGTTGATAATCTTTTGAACGTTACCTTCATTGGAAGCTGAATTTAAGTAGGACAG
TTTATTGAACTTACAAGAAGGTAATAAGAAAGCAACATGTGTCAACATTATAATTGCATTACCTTGGAAATTCCTTTGCAGTCGAAAGAAATTCTTCCCATGATAGATCTTGTTCTCGCA
AATCCACATCCAGCCTGTTCCCAGTTGCGGGGATCACAATAGCCTTACACGACCCCCCTTGTATAACCCGACTGCAAGAAGAAACAAATTTCCGTGAGAAAGTGCAGTGAAACTATAAGT
TGTTCGAGAACCAAATGCATGTGTCAAATGGTAGGCTTCCAAAAAACCTATTTTCATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNCTTTTAACGCCTACGGTGACTTAAATCTAAGTTGACAGATTAATCAAGCTACCAATTATTAAGATCATTCCATCTAGAAATATGGTTTTTGGTATGTTAAAGATAAAGATCC
TCGCCACTGGAAAGAGGAATATAAAAGTTCCCTTGTAACTCGCGACTCTCTTTCACCAAAGGCATTGTAGGATAACGCAGGGTCTTGTGTTGGTTACTTTACCTGTACAAAGGATACTTC
TTGCCTCCTCTTAATATGAAATCCTGATTGAAATATGAAATAAGAATTAAACATTGAAAAGCAATGAAAACAAAGTCAAATGTAAAAGTTAGTGATATTTAAAAATTGTCCCTGTTTATG
GCATCCATATATTCTAAGCGTCAAATTCTGTACATTTCTAATTCTTGACTTTGAAAACAAATGCACAAAGAATCTAACAAAATGCAATCTTCAGTTTTCAAAGCCATGAAAACATCAAGA
CTCGGTTAAATTCATCAGAGAGGAAATCAACAACAATGACAATAATCTATTTTGAGAAATGACTACTTGAAAAGAGGTCTTTTCCCCACTAAAAATTTACTATATAAAGCTCATGAGTCT
CTTAGCTACTCTATTTTTTGAAGTTTTTAACAAAATTACCTGAGTAAATATTCCCTTTGCCTTTGATATACGCAAACGAACTGCAACTTCATTAGCAGCAAAGCTGTCAGCAATAGAAAC
AACAACAAGCCCTGCTAGAACAATAGCTAAATAGATGACAACTGCATCAACTGTCAATGGCATGTCAATAGCAATGGCATCGCCCTTTGAAAATGTTGCATCAAGTGCATTTGCCACCAA
CCTGCATAGCATGCCAACATCTCATTAAAAAGAATAACAGTCCACGAGGTTGGTTTCATGTTGATTCCCCAGAGGAGTGTTAGTGGTTTTTTTACGCCCTTGTAAAAAGATGTACGTAGT
TATTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGGAAGATAATCATAAACCGCTTTTCAAGAGAATTGCTTGATACTAAAGCTCTCCTCTCATTATAATCAGCAATATTTATGATC
AATTTGATGAAACGTCGGTAGTCAAAGAGAGGAGCATACGTTACTTTCTCTCGAAGTTGTTTGAGTGTCATATGATTCACATTTGAATTATCACAGCCTTCATTCCTCCACACAATTGCC
AAAGAATTATCATCTTTCAATGGACGACTTGAAGGAAGCAGACAACACTCGGCAATGTTCAAAATGGAGTCAGGGAGCCATCTTACATTTGACTTCTCAGTCCTATCTAAAATACACCTT
GGCGGTTTTTGAAAAGTAACAGAAAGCTCGTGAAGAACAATTGACCAGTAAATCTATAACCACCGAAACACAAGATAAATCACGAAAATGAATGCAATTTCCATATTAAAACCCCATATA
TACAGAATTGAATCCAAACCTCAGGACTCTGATAGGAGAGTTTCTGAAACAAGCTGAAACTGGAGATAGGATCTTTATATGAAGCTCCCAACAGCTTTGGACCATGCAACTCCATGATCT
TTCCCAAGTTTGTCAGTTTAGATTGATTACTACAAGTAGAAATATGACAATAGGCATTACAAAGACACAGAAACTCTATAAAAATTAGGTGAATGAAATGAGAAACATTACATAGAAGGA
AACCAATATGGAGGAGGTCCATTGGAAGAGATATTCCAATTAGCATAGACAGAGTAATAGAGAAGGTGATGCAACTCATATGGGTGTGTGGGTTTCAAGGCTCTTCGAGCCATGAGCTCC
CGCCAAACCTCAGTAGGCTTTGATCTTTGGGCTGTGGACAGTACATTCTGAAGAATCCTGTTAAATTCCACAGCTTCATGGAGATTTAAGCCTGTTTTCACTAAATCTTCAATATCCAAT
TCCCAAACGCTCTTTCTCATTTTGTTTTTCCCTTCGAAATCAAAACTCCATTGGGGACAATTCAAGCAGAGTTTGAAACAGGTTCATTTGAAGGTGTTTTTGAATAATAACAAAAGAGTG
GCTATTGATCGGCCACGGTTCTACCAACTTCATCATTTATGATTTTACCATTTATAGCTTTTAGTGAATGTGACGCGTAGTAATTGGATGCAAACATTTATGCGTTTGATGGGACAAAAT
GCAAATAATAATCAATGGAACCTTCAACTTGATGTCTAAAATAATTCTGAAAATTATGATAAATTGAAGACTCAATTTTTCATTTTGAAGATGTAAAAGTATTTACTAATTATTTTTCTT
TATTTATTGATTAAAAATGTTACCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNGGTTAATAGTTTAAAAGTGTTTTTTTCACTATAAGTACATTTCCTTTGTACAGGAAAAAAGATTTATAATTTGAGGTTTTACGNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNGCTATTCTATAGTTTAATAAAACCTCGTAAATAATGAATGAGTTTTATAAAATCATAATGATTAGGTTCTAATTTTTAAAACCATATTTTACCTAGTAGAACGTGTCCCAGAGT
CATGGAGATTTCGTCTTTATCTAAAAGTCGTGTAATATACTTGATGTCTCACGTCGAGTATACTATCGACATGCTTGAAATATCATACTTGTAAAATATATACACATGCTTGGTTTCAAA
GAATATGTTAATGATTTGTGTGTATACACTCCTGTTCAAAATTTATTTGTGTATGTGTACAGCTAAAATCTGTCTGAATCATCAGAATAATCTCCAAAAGACTATTAAATATGCATCNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAATCGTTTTTCCTTTGATTGATACCTAAATTCCGAAGGGCTATATGTTCTAGTGCACCTTGAAGGCTTGAACACTCCAAAAGAACATTG
ATACATATAGAATAATCTACAAATCATCTATACTATCCACTCCTGCATCCAAGAACTTTCAGGTTGTACTCTATTCCATGTCCTCGTCTCAAAATTTGCTTTCCGGTGTTCTTGGTCACT
TCTTGTGAAAACAGACGTAAATTACCAAGTGAAGGGGGAGAATTGGAAGCAATTTCAGAAAATGATAACCAAAAAAGTAGTATGCAATTGTATATTAGTGGTTTGAGATTCCATTCATTT
GGCGAAACGTAGCGTCCACTCAGCAGCTATCTCGTCGTGTTTAGCTCTGTCTGCCAAGTACAAGTGAGCAACACCAGGTGCATTTGGATCATCTGCAAAATTAGTAAAATCCAAAATGAA
TGTGAGATTTCAAAGTTAACATCAACTAGATCAATTAGTTGTGTAGAAAAGATAGCACATTGACATTGTATGTATGCCTTCTCTTCATTCCCACTATATTTTCATGGAAAACGGACCAAC
CATCTCCTTGATCAGGATTCAGGTTAGGTACCAATAACAAAGCCCTGCCTATTCCTTTTCACAAGATAGTCATCCCACCAGCAATCGTTGTAACTAGAATTCTTTTTACTAGTAAATACA
GTAACTATCTATAGCCAAGCATATATATTCATGGAGAATTGTATATACACTAATTCAATTTCTCTACAAATCCTCCATTGGTTCCCCCAACCAATTTAGTTTCTATTCCTAGTAAATTCC
TTCCAGTAATCACCAAATCGCTCCCTTTGAAAGCCCAACCTAACCAAGCATATATCTGCATCCTTTCATTCTTACACTCCTAGTGCTTAATATTGATAAAAGGTATCTACTCCCCTCTGC
CTCTTTAGATGTTGTAATTGTAATTTGTAACTGATTTTAAAGAACTCAATGCAGTGCGATATTTCAGTTCACCTATGTCTCAGTTCACAATTACCAAATAAAAAGAGAGCAGGTTTAGCT
TTAGAGAAGCCCTAGAAATAGAAAAGCATACGAACTATAAACTACAGTATACAGTGACATAAACAATGAGTCCAAAAAAATGAGGCGACTCACAAGGGTTGGGATTTGCGAAAATTGATT
TCACTGCAATTAACACCTTTGCGATTGTTAACGCAGGACTCCAGTTATCCTTCAAAATGTCCAAACTTACATTACCAGTGGAATCAACATTACAGTGGTAGATTCGGGTTTTAAATACAA
CCTGCAGACCAAATCCTTCTTGGTAAATAAACATGAGTATAAAACTCAAAACAGTACAGTGTCAGGTCAAGAATGACCATTTGATTCTCATGATGAAGGTAAAAGAAAATTTGGTTTTTG
TATCCTAAAATTTAAGGATGTGAGCAAGAGTACCTTTGGAGGATTAAATGGATAATCACTTGGAAAAATTATGTCCAGGAAAAATATGCCACCTTCATATGGCGTTCCTAAAATAAGACA
GAGATATTTGTTAAGATTACTACTGTTGAGAAAAGCTAGATAAATTTTATCAGTAATTTTTCCTCATATATTCAAGATAGTATTCAAACAAAGCCCTCATATAATCAATAATAAATACAA
CTTTATAGACAAATGGTTTGTAGTGCATGTCTAGTACGCAAGAGAGAGAAAACCTGGGACGAAAAGAGAAGAAAATGAAGTGATTCGCTGGGACAAGGTTTCTGAAGTTTACTTCATTAA
ACAATATGGTAGATAAACATAACTTATACACCATTGGTGCTTTCTTGTATTGTTGTTGTCTAAAACACTAATATCAGGTATAAGCAGCATAAGCACAGCTTTTCTCTCTATTGTCCGCCT
TCCATACCATTAAACATCGCCTATGCCTCTTTTGCCCTTCAGTGCATTTTTTTCTTGTCTAATAAACTAATACTAGAAACGAATTGCATGAGCTAGGTTAATCTCTCTCTTGTCTACCCA
TTCGTTCAGTAAGACTCAATGAGGAAGCCAATAAAATACACTGTTTTAATAAAACAATTCACTTGATGCAAAGGAGAAAGGTAGTTTAATAGTGACCTATAGCAACACATGACTCTCCTT
GTGTATTCATCGTGTTTAGTTGAAATCCTGGCTCAGATTTCATGCACTCATCTCATTCATTTAAGCATATGTGTGTACAACAGTGACGTGTGGCTATTTAGCAAGAGAACGTTCTTCCAA
ATCCTTGAGAGTTTTGGTATCAGAGAGCATCTTCTCCAATCATTTTGTATATTTTTGGGTGATATTGAGTATATAGACGAGAATTGACCGTGTAACAACGTAGGAAAACCATAGCAGAAC
CTTGTGTATTTTTGGATGATATTTCAGCTTGTTGCTCTAACAACTTTAATAAAAGATTTGTTTTTGATAACAACTTTAGTCTAAATGTAACGCCATCAATTCAGCGTGAAAACTTATGTC
TTAATTCCTTGGCAACTAATCTAATCGTTTATTATTTGCACAAAATACACTGAGACAGAGGAGCATAGCACACCAAGTACTTGAAGGAGCAGTATATGCACTCCTGACTCCTCCCAACAG
TGAACATCTTCTTCCCTAATCACTTTCTTTAAACTTGTGTTAAACATTTGCTTGTTCAAAGAATATGTTTTGAATCAGGTAATAAAACCCCATTAGAGTTTCAGTGAGCATCTGTTCAGG
AATCGTAAACAAATGAGATAAGCAACATAGCTTTAGATGGTTAAATTATCCAGCCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGCAAAGAAAGAGTGCAATAGCTC
ACTGAAGGAAAGTGTAATCCTAACGGTCATGAGAAATCATCGAGCTGAAAAGCAAGAAATCATGGAGCAAAGGGAGGGAGAAAAAGAAGAACAAAAGCCAAAAACCGTACGAATAAGAAG
CGATAAAGCCCAAAGAGTAGAGTGAAAAGTCGCAACTACCTGAAGGGCCAAAGATGGTAGCGAACCAGTGGTAAAGATTGTCGCCCTTAGGGCCAGCGGAGCAATCGGAAGGTGGGTCTA
AGTTAAACTCAGTCATTTCCCTCTGAATTCTCTTGCCTGAAGCAGAGACCGAGGTCGTGGACGCCCATGAAGTTGGAGCAGCTAAGGAGATTGAAGAAGACGATCTTCCCCCACCTAAGG
GAGGCAGTGGCGGGCGGTGGTCTCGATTTCCCACCATTAGATTTCAGATTTTTGAATCCAACACTGACCATTAGTTGATTATAAACTTAGTCGGTAATCGCTGTACATGATGACGATAGT
GTTCAAAGTATGTGATCAGACCAAATTGCTGGTCATGATTTTCATTTCTCAACACTATAGTTCAGATTTTGCATCCCAATTCCATCATCCATCAGTAGTGTTAGACTCAAACCTTCATAT
AATTTCCTAACATTGGTTTTGCCATGTTTAGTCTTTTCATCAACAAAATTAATTAAATTCAAGTATGTCCTTAATTCCAAATGAAAAGTTTAAATTTAGATGATAATATGTGTAATCACA
GTAGATTTTCTTGTGTAAGTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAAATTCTAACTCAATTGTGTCTATATCAAATCTTCTAACCCCATGTTATC
TCTCCTTTTAATCATTCTAATTTTAGCATTCGAGCTCCACAAAGAAATTTTAAAATCTGAAGTTAGGTTAATGTTTGTTAAGGAAAGACTTGTGGGTGGAAGTGTAGGATTTTCTCTGNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAACTCCATTATAAAAACATTAAATTTAAGACAAGCAAGGATCAAACTTGTTACATAAAAGCATAATTTGAAAGGGGCA
ATTTTTATTTCGAGTTCATCATCGATAAACAAATTTTGTATCAATGGTGAAGTGTGAAATTATTATCATTTTTTAGATCAAATTATTACAGTAGTATACTGCTAAATAATTGGACAACCA
TAATCTTAATGTTCATATATTGGACTGATCACATTTCATTAATTCTATTTATATAATTACAAAGGATCTGTACATGATATACATACTCTGGTACAAGAAGTTCAATCAAAATGTTGAACC
TTTCCATTCCTTGGTAGCTTTCCTTTAAACAAGGAAGTTGAAGAACCTAAAAGTGCCGGCAACTTCAAGTCAAAAGCAGAAAGAAAGCAGCAGATAAAAGCATGGGTGACCACAAGAAGT
GAAACTGCCTGGCATCAAGTTTTGAAGTTGAACTAGGGGGGAAGAAATCGCTGGAAGGCCCCAGGGTCAGTGAAGGAGTTGGGGGTGAAGCTCCATTCCCACCGCTTGGATTAACACTGG
TTACAGATAATACATTGGCAATTCTTTAGATAAACCATATTTCAGGAAGCAAAAATATAAAAGCTCTCTATAACTTAATAGCACAACACCAATAGCATCTTTTTGCTCACCTTCCAGTGT
ATATGCAGGATCCTCGACCTGCAAGAGGGCACCAATATTAGGAAAACTGTATATATACGCCTCCACGACTGTATTTTGTGCATGTGTTTATTATTATACATGTGGAATGGATAGGTTATA
CTTAAAAGGAAAGAGATGATCAATATCAAAAAGATGTAGCAAATAGCTTGAAACTAGAGGAAACCATAAATGAAGAGTATTATCGTGAAAAGTTTAGCAAAAGACATTTTCTCAAAGTTC
ATAGTTAACCCCTTTATACTGTGCAATAGCTAGGTCTGAAAGTACATCCAAACTCAACACTCAAGTTCCATCGGTGTTTTGATGGTGCTCTAAACCTAAGCACCTCTTCATGCACTCTAG
TCAATGAAATTCTTTTTCCTGAGGATTGAGAACAAGAACTTTGATAGTTGGTATTTAAAACACAGCAATGAAGGTGAAAGTAAGAGAGTGATTAGGCTCGAGGTTCGTTTGATTGACTTT
CTAAATGCTACTTAAAAATTATGTTTTTAAATTGGAAGTACTTGAGAAAGTCAATCCAAATAGGCCTTCAACCTGGTTCATGTTAGTGTAAGTTGGTTCAATTGAGGTCCAACATATTTT
GTGGTCAAACCAATCGCTCTATCAGTTCAGTTATGAACCCATTTCCCTCTCGTTATATACATTCTACTATTTTCTTCATGCCTCGTGAAAATTATATCCGATAGAGGAAAGACAATACAT
CGTCAGAGATAAAGCAAGAACTTGGAGAAAGGAACTTACTTGGGTTAGTATCAGTTAACGTTGCTGTGCCATCAAAGTTGCAAGATCCACCATTGAGTTGCATTTTCTGATAGTAGTCAT
TATAAGCATAAGAAGCGTGGTTTAAAATGTTATCAGGAAGAAAGCATGGCTGCCCTGGTTGAATGGCAGAACAATTAGCTCCACCTTGACCACAAGCCCAGTTCAGACCATTTTGCAACT
TCCCAGGATCTGCACCATCTTTTGCCACACAATAAACAAAAGAAGAACTTCCGGTGACTCTGCTGGATAATGAACTCAAACGATATATAGCAGAACCTTTAGTTGAAAGAACTCCCCAGG
TTTTCTGTGACATAGGCTCAGGCTTCTGGTCTTCACTGAACAACTCGTATATGTACGTGTTAACAGGTTTAGTTGGCTCGCTAGGTGGACCTGAACCATTCAGAACCCTGGTGATAAGAT
TGTTAACATATATCTCAGCATTTTTCTTGGTAGCAGAAGGTTCACTGGCTCCATCAGACCATGGCCAACCAGATGCTGTGACCACAATAGGGATGTCAGAAAAGTTGAGAGCTTTTATTG
AATGATAGGTTGCATCCAACATGGCATCAAACATGTTGTTATAGTGGAGGAGTGTGTTTGGATCAACAATCTGCCGATTTATAGACAATGGCTGGAAAAGAGCATAATCGAGTGGGAAAT
TTCCATTTCCTTTAATGTATCCATAGTAAGGATAAACATTTAACATATAGTAGGAGTTAGTGTTCTTCAAAAACTGAAGGAGTTGGTAAATGGTGGAGTTCAATGAAGAATTGAATGTGG
CTGTAGAGGGAGGAAAAGAGGTAAGAATGACATCCATCGACTGGGGTGTTGAAACTTTTATTTGAAGATTTAGGTTTGCAGCAACAAGAGCTTTATGAAGGTATTTCATGGCACGAAGCA
AGACTCGAGCTGCATTAGGGATTGAGGTAAGAACCTCACTGCCTACAGCAATAGCTGTTATATTGGTTGCAGGTGTATAAAGTACAACATTCTTATTAACCCAAGCAGCAGCAGCTGATG
GAGACTTTCCAATTTTTAGAACCTCCTCATTTGTAACACCAACCATTACTTCAGTGCTACTATTTGCAAAGGCTTTGAGTAATTGGGCATTGGCATCATAGAGTCTAACATGAGTAAACT
CGAACTGTTTGAGCATTGAAACCACATCTGAGGCAGGTGGAAGACTGGAAACATGAGTGCCAATATTTATCCCCACAAATGCTCCTGAATCTCCTGATCAGATCAAAGAATTAATGAATA
CAAGAACATAAAAGAAACTGGGTACCAATGGAGAGATTGGAAATTGGAAGTATTACAGATGGAGGTAACTGTTAAATTGAATTTTAGCATTAAAGTTACTGGAAAGAGTTCATAGAAGTA
CCTCTTACATGGAAAATCATGAGAGACATGAGCAAAAACAGCACTGCAGGCCACTTCTCATGCATCATCCAGTTTACCAAAACATCAACCTCAAATATTACTCTTCGTTCCTTCCGGACG
TCCTTCATCAGTTAAGTTTAACCAGCCTATAAAAATTGTGACGAGATGCCATGAATCAGAAACAAAACTCCACCAAAACAGCAAATTCATGAGACTTGATAGAATTCACATGTTGACATA
CCACAACAAAGTTATACCCGTTTCATATGGAAAAGAGGGAATACTTTCTTTAAGGTAACATTCCATGCAAACATCAATAAGAGAGCATAATCCCATCTTACACATAACAATCACAACAAC
AACAAAAAAGAAAAACCCTAATAATTACTTGATGAAGATAAACCCATAACAAGAAAAAGCCTAAAATCAAGGTTTGGCAAGCAACAAAGAGTTAACCACAGATTACCAGATAAAATATTA
ACACGTGAGCAGAAGTGAAAGTAAAACAGAAAACACCAAAAACCCGCGCTTTCCAGGCTCATAAAGTTAGCTCCATAACAATTAAAGAAAACCCAAATAGAGGGGGGAAAATGGAAAAAC
AAGAAAACCCAAATAGGGGGGGGGAGAATGGAAAAACCTTAAACAAGAGCTGAAAGAAGAGTCAAACTATTAGAATGAAGCATCATGAAACTCGATGCAAATGAAACAAAACTTCACTAA
TCATCACTCCACTGAAAACGACACTAATGAAGAAAAAAAATGCCAATAATGAAGAACCAGATAGTACCTTCCCTCAAACACAGAATGGGAAGAACGAAATGGCTGACCAACCCAAGGAAC
ATTACGCATCGAAATCAACGCCATGTGTAAGTGTAATGTTCTTCCGCTTACGAAATCGAAATGTATTTTTAAATTACAAAAAATTACACGAAAAGGAAAATAAATATTATCATATTCAAC
CCACCGAGAGAAAAAGGGAGAGATCGTCCCGTTGATTTCCCTCCAAAATCAGTTCAACTCCCAGCTGAAACGCGCGCCAAAGCCGAAGAAAAGAGTTGGGCTACTCATTCATATGGCCCA
TGGCCTTCTAAGCCCAGTAAGGGCCATAAATGTTTTGATTTTTATCCTTGCAAATATAGCCATTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAATGAAAGCAGCCCATTTACAAAACGATG
TTCGGCCTTTTGTTGAAAAAAAGAGAGAAAAGTGATACTTCCAAGTTAGGGATATTCATGGTTCGATTAGATTTCAAGCTAAAACCACACCAAATCATAAAATGTAAAAAAATCTCATAC
AAGATCGAACATAACCAAACATTTGTGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCGACTAAAAGTCACGGGAACTCATAAGAAGTCAAATGAGAGAGTATTGGGGTGGGTGTGA
CTGCAGGGGGACTATGTGTATGTCGGATTGGGCTGCATTATTCTATTTTTGGTATCGGCCGACTTGTCGGCCCGTTTTCACACTTCTACCCAACCAAATTTCATATTATTATTATTTTGT
TTCCAAATTATAGCACTTTGATGTGAAACCTCACCCAAATCAATGGTTTCAAATCACTCCAAAATTATTCATTTATATATTTATACCCAAAATTACTGTACTTTTAAATATTCTAATTTC
CTAAAACAAACTATTTAACCTTCATAAAAAAAATTATAAACTCATGTTTGGGAGCACCTATCTATTCAACATTACAAGAATAATATGAGTAATTAAACAAAATTAGATGCCAAGTAAAAA
TACCCCAAATGTATACAATAGATCTAAAAACAAAATGTTCGTTGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTTTCTCTTTCTTTTCTT
TTTCTTTAATCAAAATTAAAATAAAACATATCCATGATAGTCTTTGTTATTACACACTCAAATTTTCAATTTTTAAAATTAAGTCTCGAAATCTATACAAATATTAAAATTAGACTCTCA
AATTTAGGATCCAACTTTTCGAATTATAGAACAAGTCGAAGAAATGAGTAGGAAAAAGTGGGTGACTTTGGTAAATCTCCACTTTATAAGTAAGGAAGAATTAGTTTATATTGTTACCAA
GATTTGCACTTTTTGTCTCCCAGAAGGGTCACGTTTAAGTGTATAAAAGAATATGCATATTTGACCTTGACTCATATTCGTGGTACACAAGCAGAGAGAGTTTTTAATTCCAAGTACTCT
TTTACATTAAAACTTGCCTGACAAGTTCAAATTCAACAAGGACTAAGACAGACTACTTGTTTGAAAAAAAAAAGAAAAAAGAAAGAGGGTATTTTGGTATTTTCATTATCATCATTATCA
TTGACATTTTCTATTTGTATTTATGGTGTGTTAGGTTAGCTTGTAGATTAAGCATCATCCAAACTTCTGCCCTTTGACTATGAGACAAAAAAATATAATGTGTTATGTGCAGATGGCAGA
TTTATAATGTGGCCTTCTGGAACTGTTTTACTTTATAATAATAATAATATGCAACACAAATGTGTCAAGATTACTATTTTTGGGTTCTCGTTTTTAATGACCGTCGTCTTTACTTTTTAA
CTTCTTTTTACACTTTAAAAATAGGTATCTCAATTTAATTGTTCACAACTGCATTTACCAAACTTTGTTCATTTCTCCATTTTGTTGCGTAACACAAGATCATCCATTCAAAATTATCTC
TCTTTAACTACTATGTATTGTATAATTAGTCTATGTATAAGTTGAAAATGATGATAAGAATATGTCGCATTATTATTGTTTTGTGATATTTTTAAAGGTGGGAAATATAGTTTTAAATTT
AGCATGATATATATGATAAATATTTGAATTGTTGATTAATATTTGGTAATACTTTTATAATATAAACAATAAAAAAGAAAAAAAGGTTAAGAAGTAGTTGAAGAGATTATAAACTTAAAA
ATCTTGTTTTTTTCTTTTTTCTTTTTAGAATTAAGTTTAGTTCTTCTGAATTTGTTGTAATAGTTTTTTCCCTTTTCTTAAATAAATTACTAAAATTCTTGGTTAAATTCTAGAAAAACA
TTTAAAAAAAAAAACTAATTACTCTTCATTTTCAAAACTTAACATAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTACAATTTTGCCAATATTTCAATTCTTC
TTCATCTGTTTTTTATTTTTTTTTGTCACTTTTAAAATCGTAATATCAAAATCTCAACATAGTTACTGGCCAAATATGAATTTTTCTTTTTATTTTAGTTACAAAATAAGATTGTTTTTT
CTTGCCTATAGTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NATTGCCTCTAATTTTTTAAAAGAGAAGGTGGACAACAAAAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTCATTAGAGTCTAATAATTTTAAAAAGTGAAGTGAATTA
AACTCGNNNNNNNNNNNNNNNNNNNNNGAAAATAGGTGTGAGTATGAATGCAGTATCCGCCGTCCAGTGGTTGTGTATAATGTGTGGTTGGATGTGGACATACGACTTAGAAGTTAGAAG
TACTTCCAAATTCGATATTCACGCGGTTCCATTCTGGTCCACGCACCTCTACTGCACCCAACCAAACCCCCATTATTTCTTACGTCTTCTCGGGTCTACCCTTATTTCACTGCACCACTC
ACTCTCCTTCAATCACCACCCTCCATCTCATTTTAGCCAACGCCTACAAATCCATCCTAAAACAATTAAACAAACCTACTAGTACATATTTCGTTAGCACTCATTTGNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATATGAGTTGGACAGTAAATTCAAATTTGAATTATGATTGTTAAAAATGTATATAATTCTATATAT
TTTAAATCGCGATAGACTGTAATCGTCATTCAGTNNNNNNNNNNNNNNNNNNNNTTAATAAAATATGTATTAAATAGTTTAATTTAAGTCATAAATAAGTGTGAAGTTAGTAATGTATTA
TACTGTTTTTCTATGTGTTATGGTATATTGATTGATATAAAGTCATTTTTAATCAATTATTATTGAATGATGTTTCCAAAATCATTGAAACATGTATAATAAATGATTGAATTTTAAATA
CAAAAACATACAAATACCCTTTTTTTTGTTTGCTTATCTCTATAAATAATTAAGTAATTGTTTTAGTTTGTACATATAATTTCACATGCTATAAATTGGAGGGTATGATTATGCAAATTG
TAAAAAAAAAAAAAATAAAGAAATTGATTCATGTTGTTAGAATATAATTTTTAATTATAGACATCATATATTGTATTTAACGTTATCATAATTATATTGTATTGTTTTTATTAAAATGTT
GACACCATAATTGTTTATATAAAATGCACTAGTGGAAGTTTGAACCATTCTAATGCAACTTTAGAGTAATTGTGTGTGTTTTAAGGCTTTATTAGTTAGTCTAGGAAGATACAAAGNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNTATGTTCAAAAAAGACATAGCAAGATAAATAATCTCGATACACTTCTTAGATTTATTCAAGGCCTTTAAGGAGTCGTATGAGGTGAAAATCTCAT
GTATTGTTTTGTAATAGCGATGAGAATAGTGATGTTATTATCGACTATGATTATCTAACAGTTCGAATACCGTTGATATAGTTGAGGCTGAATAAAAAATATGGTTTATGGGGTCGGAAT
TTGTGGCGTCAACCTATAGGATTTGCTGTTTTTCTAATTTCTTCCTTAACATAATGCGAGAGATTACCTTTCGATTTACCAAAAGCAGAAGAATAATTAGTTGCAGGTTATCAAACTGNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNTTATTGTTACCACTACATCTAAGGATGTAAAAGAATTGGTAACAATAACATTAAAAATGTCAAGAAAATTCAACAAAAGTTTAGCTGTGTAACAATAGTCATATCAACAATA
ATAGCGATAAAATGTAATTTCTAGACGTCGTCCTAAAACTATCGATTATAATATATTTATATTTGGACATGAATTATATTGATAGATGTATATTTGAAAATAAGGTGGTAAAAGTTAGAA
AATTTGAAGGAGTATGAAGAGGAATAAAAATGAAGGGGAAGGAAGCATGGAGTGAAGATAGAGTGGTGAGAATGTAATATTAACTAAAAAAGAACGAAGTTGACGTTTTCTTTCAAAGAT
ATTTTGGTAGGGAATGACCCATACGAGTGTTACGAGCCAAGGCGCGTACAATCATGTACGAAATTACGAATGTATAGCATAGTATGGGATTGGGGAGCGTCGGTGCTGACACGCATCATA
AACGCGTTTACCCAAACCCATGGATAGCGTTTTTCAGTCTCTCTTCTGAGCCATGTGCTACGCCACAGTCATTGGTCCGTCACGGAAACTGCTTGGTGAGGCTATCACTTCCCATTTCCC
ACACCTACGAAAAAGGAAAAAGGCTAAAGGATTTAAATTAGTTCTTTTAAAAAACACATGTATAATATATATATATATAGATATTCACTCTTTTCTTTTATTGCATATTTGAATTCAATT
CTTCCACCAATGAAATTTCATAAAATCTTACAAAAGTTCAAAATAAAAAAGGTTTGTGGTAAAATTTAAAATAGTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNCGTCCGTTATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTATAGGTAATTTAATTTGAACACACAAAATATTAACAATGATATTTGAAAAG
TTTAGGAAGATTTAAAAGAATATATTTGTTTGTATAGAAAGTGTGAAATTTAGAGTAATATATTTGGGAGAAAGAAAGAAAAGAGAGAAAGAGAGAGAAACCCGGCGGCAGGCATGGGAT
TTGGTTGTGTAAAAAGGAGGTGTATTATTAGCAATAGACAGGATCACGTGGACGAGTAAGTTTCCGCCAGGTGGGTGTCAAGCAATTCGTACAATGCAGAGTACCCACTCGCTATATACG
AATTTAAAAGAAAAAGAAGAATATTATTTATGGATGGCAGATCTGAATTTGTGAAACGACACTACTTGTACTGCTAACGATCTGTCGGCTTCGAGTCCCCTCTCCCCTTTCTTTTACTTC
CAATCATTTCACATTCACATTTCCCACTTAACTATCACTATATACAATACTTTATTCCTATTTTATAATCCAAGATCTCATGCATNNNNNNNNNNNNNNNNNNNNNNNNNNNACAACTTA
ATTACACTTACACAATTCCTAATATCCATTTATACTACTTATTATAAAATTAATTATCCTCTTAATTACACATCTCTCTTCTTATAACTTAAATAATGTTAATAATTACTTCTAATCCTC
CTTATTTTATAAAATAAAATCAATTAGTACATATCCAAATTTCTAGATTTTTTGCAGTAGAATATGAATTTGTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTCACAACTTAT
TTAAAAAGTACCATAGTTTTAGTTTTAAAGAATAGTTGAAGATCTCATCTCATCTTTTTTTTTTCAAACCCTAGATACATCTTTTGTAGAATAATATGACATTGAATTTACTTTCATAGG
TTAGTTTAATTTTTTTTATATAGTAAGTGTTGAATGAAATAAATATATTGAACTTACCCTCATCTATTCATTTAATTTTTATTTATGTGTTCAAATCTTAAGTTAATATGAAAAATTCTT
TAATATTCTTCTAATATATTTGCAAACCCTATTTGAAAAGTTAAATAAAGAACTAAAATTTTTATTTTTAAAACTAAGAACCCAAACACATATTCTAATTTTAGGGATTAAAAAGATGGT
TTTCTCNNNNNNNNNNNNNNNNNNNNNNNGCAACGTTAAAAATGTATACAACAAGGAAAAGATTTATGGAAGTGTGTGAAGTGAGATATTAGAGAGTATATAAAAATGAGTACAAAGTTC
GATGAAGTAAAATAAAATGAAGATCAGAGAATAATGAGTGGCAATAATGTGTACAATGATATGATAATAATAAACAAAACTGGTTTGGGACTGCCCAATAATTTTAAATATTTGCAAATT
AAAAGAGTTTGACTTTGTTTTTTTTAATTTAATTTCTTATGGAATAATGGTAGAGAAATGACATACAGTTGTCAAAAGAANNNNNNNNNNNNNNNNNNNNNNGTGAGATCTAACCATAGN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTTACAGTTCATTAATTTTAATTTAGAGATCTTCAAGTGGCATGCATAAATTTTAATTATATTGTGGGAGATTCAAATAATTA
CACACTACTAAGAAAAAGNNNNNNNNNNNNNNNNNNNNNNGACTCTTTTTCAACACACNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCATATCACAAGGGTTGTTCCAATATGTCACACC
TAATTAAGTAGCTAGGCTTAATTATTATTTAAGTAGAGCATTAAGTAAGTTAAGTAAAACATAATCACATTTAAAATTCGAACAAAAGTTGACATTTTGAATGATACCAACTATATATCA
ATATATATATACACAACCGATTAGATGGTATACAAAAACTAGCCAATTAAAATAATATCAAAACACGGTTGATTTACCTCGGTCGCATGTTGATTTGTAGAGATTGGCTTATGTTATAGG
AAAAGTGGTTTTCTTTTAAAATTATGTTAGGTGGGGTGTAATTGCATGAAGTTTAAGATTAAATGATTTGGAAATTGATTTAATTGGGGTTATATATAATTTAGTAAAAGAGATAGAAGA
ATAATAGAAGAGTATTAAATGGTGATGGATGTGGGACATTTAATTCTTGAAATGTAACCCAAAGTATTTATTAAATTTGTTTGTATGAGTATTATCAAATGGATAAGATGAAGCCACGTG
TAGGTTGATGCGACGTGTAATGTAGAAATTATATATAAGCAGAATGCGAAAGACATAATACATAGAGGAAGGTATGATGACAGATAATAGAGAAGTAAATATATATTAAAATGCATGCAT
GACAGCACCAATTTTTCTTTTCTTTATTATTTTGTTGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTAAGTTTTTGTTACACTTTTTTGGACTTTTATGAGACTTTTGTG
TTGTGTTATATATATATATTTTTTCGTCTCTTTTATGTATATAAAGTAGAGAGAAATTTAAGAAAATTTGTAAGATGAAACAGACCTATTAAATTCAATTTATTTGAGCAACCAAATCTA
AGCAAATCTCAATTGAATGGATACAAAAATCTTTGACAAGCCATGTAGAGATTTAGATATCTTTTCATTATGAATAATGAAGTAATACCCAAAATTCACCTATCTAAACTTTAAGGGATG
AAAGCGGAGAATGTGCGTGTGAAGAATGTTTATCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTTTGTTGGATAATTCATGAAATCGACGAGTTGTTACAATACCACAACTAGAAATGTAGTCGA
TGCATGATATATCTACCCGACTTTACACTAGCTTCCTCACGTTCCGATGACATTAGGGTTAGAGTTTAGGGTTTCGGTGATCTCTCAACCTATCTCCATAAACGTACTCCTAACGTGGTA
TAAAGTTTGAAAGTCTTAAAAGCATTATTTACTTGCTTAATTATCATTAAACTCAAAATGGAAAAAGGAAAACCAACTGTTCAAATGGGTGTGGATTAATTTTAATTATAATTTGAGACG
ACATTTCTATAATTTAAAAAGTTTGAAAATCATATACTTAATTTTAAGGAAACTCAGTATCAAAGCCACATGTCCTAATTCCTTTAATGACACCAAAACAATTGGACTATACACACACAC
ACACATACAATAATTTCAAATTTTAACTTTTTTAAAAAAAGATTTGAATCTTTGTTGTTGGTAGGAGAGAAATAGAAAGGAAACTTCTAAACACTTTTTCACATTCAAACAAAAGAAACC
CAAAAATCAATTAAAGAGAAAAAGAAAAGAAAAGCATTCATATCCATCCAAACCCTCCAGCTCTGCAAATATATAATCCAGACTCCATTTTGACTTTTAATATATACACCAAAGATTTTG
AATNNNNNNNNNNNNNNNNNNNNNNNGAATGGAAATTTGAAGGAAATGTTTTGGGTTTGGAAAAAAAAGAAAAAGTAAAACTTGGGAATGAAGCTAATTAAAGCCAATCTATGTTTGGTA
TTTTATTTAGTTGGACTTTTATTGCTTACCAATTACAAAGGAATTTTAAATAATCACACTTAGTGACATAAGCAATGGCGATTGTGATTTACCCAATAATCCCANNNNNNNNNNNNNNNN
NNNNNNNNNNNNNTTGGTTTGGTTTGGAGGGACCCAATGGAGAAAATTAATATTGTAGAAATGAAAAGCACTTTCCAAAGAAGTTTGAAATTGTCAGAACTTTCTTTCAATTTTGATTTT
AATATGAAATTCATCTTTCTAAACTTCACCTCTAAGCTTCTTCCCTCTTTTTGATGTCTCCATACAAACACTTTTTTTTTGGGTTCATCACTATTACTTCATTAATTAGGTCTTTACAAA
CTTAATAACTGTTTCNNNNNNNNNNNNNNNNNNNNNNCTAATTCACATGATATAGATTACGTCATGTTTATTCATATGATATCTTCATTTGTATAAAAATTTAACGNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATTTTATTAGATTAAGAATATCTTACGGACGAGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNCGGGAAGTTTAGAGACCAACATGTAAAGAAAAACTAAGATTGATATAAAATTTAGTCTCTAAACTTTGAAGTTTAGGCACGTTAAAATGGTATTTGAATTTTGAAAGATGTCAGAT
GGAATCATTATTGAAATACTTAATAAAGTTGTACTAATATAACATACGCGTTTTTTTTTAAAAAAAAGAAAAATTCAACTAATTTATCGGTATAAAATGAAAAATGTTAAAAATATACGC
TTTTTAAGTCGAATAAACTTTCTAAACACAAAATAGAAAATTTAAAAACTTACGAGTCATAGTATATGAACTTCAAAAACCAAAATGAGAAAAAATTAAATACTATTTATACGGAAATTG
ATTGTTTAACCTACAAATAAAACAAAAATGGAAACCAAATAAACGTAATGAACAACATTGAATCTTGATTAGAGTATGATACTATAGAGATTGTGTTTGTTAGAACCCACAACTAAACTA
AGTTTGAAAGAGACCAAATGAAAAAGGTAACTGAAATTAATAAATGTGTAAATGTAAAGTTGAAAACAAGAATGATAATAAAAATAGGAAGTCAAAGTACACATTGTTGGAATGGAATTG
AAAAGAAAATGAATGCAATGTGTGTGTGTATATATATATATATATTGGGAGTGGTGTGGGCAGTCCTATATAAACCCCCAAAAGCTTAGAATTATTGCCATTTTAGAATCATCGTCTTCT
TCTCTCTCATTTTCGATTCAAAGTTCCATTGCACTTTCACTTTTTTCTCTCTTTTTACTTTTTTAATCGGACCCCACAAGCAAAAACAGCAAACCCAACAATTCCGACGCCGTTAGCCGC
CGGTACCCATTTCCGTTCATCGTCAAGCTCTTCGCTTTCGTTTTCAAGGTCAGTACTCAACATTACTGATTACTGTTTGAAGTTGTTTTTTGTTGTGGGTTTGTTTATGTTGTTGTGTGT
TGGTATGCGTTCGTGGAATGGAACTACTCTGTTTGTTTCTATGTGTTGATAGTTAAAATGGTAGTATGCTCTGTGTTTTTGAATTTATGATTGAGTTTCAATGAAATGGGATTTGGGGCT
GCTGTTTTTATGGTTTCAATGGACCGGCGGCGGCTGCGGCTGCAAGGGAGTTTAAAAAAAGAGGAAAATAGAGACAGAGAGAGATAGAATAATGGTATTGTTTGGTTAGGCAGATCTATG
GTGATAGTGGAATAGGCATTGAATTTTATTATATCCGGATCTCTTTTGCTTTGCTTTTTGTGATCAATTGGATTTGGAGCCACTTTCTTTGAACTGGATAATTTGTCGCTTTCATTAGGT
GTTAATAGTTAATAGTTACCCGCAGAGAACATTTTTCAATTTGATAGTGCTGTACCTTGTTATAGCCTATAGACTATAGATAGACATCCTTTCTGATATAGCATCTTGTTCTTACAGGTT
ATTAAAGGATCTTATTATGCCATATGGGTATATCTAGTTCCTGTCCATTTGCAGAGTATATTGATTTGGGGAATAATTTAGAATCTATTCTGATAAAACCCACAAGTTTTGGAGATGAAG
AGAAAACTCTACTGCGGTCTGTCAGCAGAGATTCAGAATCAAAAGTGTTGAAATCAGTAAGTTCTCGAAATGTATCTTTGGAAGGATCTGTTAGCTTCAAAGGGAGAGGTTTGGAGAATC
TGTCCTCAACGGAGACTTCTTCATTAGAAACAGGAAATGATACAGATGTTGCATTGATCAGCCCAAAGAGTGTAGAGTTTGATAATCAATCTCAAAGTTCAGACAATGATATGGAAAGAT
TCCAAATGTTACCAGCTTTGGATCCAAACAATCCCAAACATGCTGCTGCGCTAAAATTGCAGAAGGTGTATAAAAGCTTCCGCACCAGAAGAAAGCTGGCAGATTGTGCTGTTCTTGTTG
AACAGAGCTGGTAATTTTTCGACCCTTCTCTTTTTCTAGGAAATAGTAGTCATGCTGCATTTTTTGTGTACGCTATCTTTGTCTTATACCATTGTTTGTTAATCTGGCAATATCTGTAGG
TGGAAACTCTTAGACTTTGCGGAACTCAAGCGAAGTTCTATATCATTCTTTGACATGGAAAAGCGCGAGTCTGCCATTTCACGCTGGTCAAGAGCAAGAACTAGAGCAGCTAAGGTGAAT
TCAGAGAAATTCCTAAATAAAACCTGTGATCAATATTTGACCATATATTTGTTTCAAATATCTAACCAGACTTTTGTTATTATAGGTTGGAAAAGGCTTATCCAAGAATGCTAAAGCTCG
AAAGCTTTCTTTGCAGCATTGGCTTGAGGCGGTAAGTAAAGGTGCTTTCAGTCAAGTAATTCTAATATATTGACTTCAATTTGTACTGATGTAATGATTTATTGTTTATGCATACAGATT
GATCCACGACATCGCTATGGCCACAACTTACATTTTTATTACATGAAATGGCTTCACAGCCAGAGTAAAGAACCCTTCTTCTACTGGTAAAATTTCCTTCTTGCTACACAATATGTTTTT
TACTACTGTGTTCCTTCAAAGAATTTTGAAACATTATGTTTAGACCTTGGACTCAAATAAATCTCTGTTTCTGAGTTCAGGTTAGATATAGGAGAAGGGAAGGAAGTAAATCTGGTTGAA
AAATGCCCGCGTTGGAAACTCCAACAACAATGCATCAAGTATTTGGGTCCTGTAAGTAAATACTACACTTGGTCCAATCGTCCTTCACTTCCATTTTTTAAAACTCTAGCACTGAACTTA
ATTTGTTTCTGTTTTATTTTAGATGGAAAGGCTTGCATATGAAGTAATTATGGAAGATGGGAAACTCGTATACAAACAATCAGGGAAACTCGTCCACACAACTGACGAAGCTAAAAATAC
AAAATGGATTTTTGTCCTAAGCACTTCAAAGACCATGTATGTTGGAAAGAAGAAGAAAGGTACATTCCAGCATTCAAGCTTCTTGGCTGGAGGAGCTACAACTGCTGCTGGGAGATTGGT
TGTGGAAAATGGTGTTCTGAAGGTAACAACTCTACAAACATAAAATCCTGAATTGTTTTCACCCTCCAACTACTGATCCAATTATCTATTACCTATTACTTATCATCACGCTTCTTTGAC
AGGCTGTTTGGCCTCATAGCGGACATTATCGACCCACTGAAGAAAATTTTAAAGACCTCATGTCATTCCTTAAAGAGAACAATGTGGATCTTACTGATGTGAAGGTAATATTGCCTGAAA
AATGTACTAGGCTTTTACGTTTTCTTCTCTGATTTCATTTTTAGAACTTCAATTATTTTAGATGTCGCCTGAAATATATTTTTTATCCCATTCAGACAAGTCCTACTGATGAGGGAGATG
ATTATCTGGACAATCAAAAGAGTAGCCGCCACGTTAGGAACAACTCATCAGAGGAGGACTTCATAGAAAAGCTGAACGGCTTTGAGAGTGAAGAGAACAACATCGAAGAGTCGAATGAAG
GAAAATCTGATTCATTTGTACAGTCTTCCATTGAACTATCTGATTTAAAGCGTCGCAACATTGGGAAAAAATTGACCAGTCTTGAGATACCGAACAGGGCTGAAGTGATTACGATGTTTG
AGAAAGAACAAGAAGATGTGGGAGCTAATGGTAATAAAGGTTTCCTATTGGAATCCCCTGTTGTTGATAGTTACAAATATACAGATAATTATTTCTCTCCAAAGCCAAACCTCTCTGATG
AAGATCAAGGGAATACTGAAGTGAAGATCATTCCCGAGGAGTCAGTCCTTAGAAGGTTAAATTCACACAGTGAAGCCAAATCATACCAACTAGGGAAGCAGTTGTCTTGCAGATGGACAA
CTGGAGCTGGTCCTCGCATAGGCTGCGTACGAGATTATCCATCAGAACTTCAACTACGTGCGCTTGAGCAAGTGAGTTTATCACCAAAATGCACTGCACATTCTAGACACCACTGCTATC
CTTATGTCGCCATTGAGATGAGCCCGAGGACAGTAATACCACCAACTTCTTAATACCACCAACTTCTTAAACCAGATGACAAGAAACCATAAGAAGATGAACTGACCATTCCTAGACATG
ATCCTCTTACCTTTTTTTTCCCTTTCAGAGGAACATAAGTGAATGGGGCAGATAGATTCATTATATGTTCATTCTTTCTTTTGTATATACAAAAAGATGATGTAGGAATTCTTCAGTGAT
TTTTTCCTACTAACCCATTTTTTTCTTCTTACATTTTTGTATAACAAAGGGAAACTGCACACAAAGTTTTCCCATCCCATGTCTTCTTATAATGAAATAGAAGCAGAAATTTTGGAGTTT
TTACAAGTCTGTGGCATTTGGTTTGCTATTTTACTCTTTTCGTATTCTATATGGTCAGCATTTCCTCGTCCACAACAGCCTGACAGTGAACCCCACTTCAATAATCGCAATTAAATTTGA
AGTCATTTCAAACAGATATGAGATATGAATCATTGAATGTGCAACCTGTTTGCGCTTGTTTGAATGAGCTGTCTAATAATTTGTTGGTGCAACTTTAAAATTGCTGTACTGGCTTGCAAG
AACTCAAGAAAGGCCTCAGTTTAATGAAAAGTAATACATGCATATTTTTTGAGATTTGAGAGTTTGGAAAGTTGAAGAGTGAAAGGTGTAGTCGAAAACAATGAATATTGCTATAATGTG
GAAAGTGGGAATTGATTGACAAGAATGATGTAGAAAGACAACGGATAAATTTAAATAAATGCTACAACTTTTTAAGGCGGCTTTTGACGATGTTGTATTAGAGGAATAAGGTCACCGACC
ACCATGTTTATTTGGAAATACAAATTGGAACAAAAACGTTTAATTACAATTTTTCTTTTACCAAAGTATCAGTTTCATCCCCTATTTTTTAAATATCATTTTGATCCACTTACTTTATCG
TTTTATTCAATCTTATTCTCACTCTCCATTATTCTTCATTTTTTGCCTTCGTACTTTCTATGAATCTTAAAATGTAGTATTTCAAGTTATTCTTTCTTTTTGCTGAAATCAATTGAAAAT
GTTGATAATTTCATGCCAAAGAATACTATGTGATTACAGCTTTACTAAAATTGATCAATTGAAAATATAAAAGTTGTAATTGAGCCGACTTTAAAGTATGAGAATAAAAAAATTAACCAA
TTTCAAGTTTAAAAATCTAATAGATTTCATTAAAACATAAAATTTAAATTTATATCCAACAACAATTATATTCTTCTTTTTTTAAAAAAAGATTGAACTTGTCAAAAACCGAAGTTGATG
ACTTTATTAAAAGTTCAAGAAATATAAATAATATAGAACTAACTTGATTTAAATGTATATAAGAAGAAAAAGGCATTCAACGACGCTATCATACAAGACAGACAACATATTAACTTTCAA
CGATTTTTTTTGGTTTGGAAATTTCAAACTTAAATCACCAATGAAAATCCATTATGTATTTGATGAGTGTGGAGTCCAATTCAACAAAAGTAGCACAAGTCTTTTAGAATATTAATACAT
TTGACTGTGAATTCCAACCCTATTCAAGAGAAAATGAAAAAGAAGAAAGAATCCACATTGTATTGGAATGACCTCTGCAGAAAATGTAGAATGGCATCATGAAAAAGTTGGAAAAGCAGA
TATCAATCAACTACCAGACCACAAAACCATTCCAAGTCCATGTTTCTCTAATTACATGTATAAATTAAGAGACATAACTACACATAAAAGTACAATTAGAGTGAAGTTCATAAGCATAAA
TCTTTTGCTCATGTCATCTAAACCCCAACATTACCTATTTACATTCCTAAAATTTCACACCTTTTTTCCATTAATATTTCATTGGGTGGAGCGGTGCCGTGTATTTCCATTCATACATTA
ACAACAATACTTTCAAGATCCAATATAGACCAAATGTCTCCGGGGATCTTTAACCACCTGTGAAAACAAATATATCAATTTCATCTCTCTAAATATCATAATTTGTAAAGTAGTCAGTCA
ACGAAAAAGTGGAAGTTTGAATACAGAAAACAAACCTTAGTTATTGTGACTTTGGTCATGCTCAATAAAGTCTAGAGCATCTTCCTTGGTGACAACATTGACACGGCTCACCCTATTTTT
ATGGGTTACACCATATATCTTGTCGGCAACCTTCACAAGCTCTGGCCTAAATGTAGTTGTTATAAATTGAGTATTTGCCATGTCTGCTAGCCGACGAATCATATCTAGAAAGTAATTAAG
AATATCAAAAAAGGAATCATGATTACAGAAAGGGAGCATATGACAGAATGCATAGCCAACGATAAAATATAATAGCAGCCACTCTTTAGAGGGAAAAAAAGAGAAAAAATCATAAAGAAT
GATGTGAAGGATACTTCCGACTGCAGTTCTATATTGAGGATCCAATGCTGCATCTATCTCATCAAATAGGTAAAATGGAGCAGGATCACATCGTTGTATGGCAAAGATAAGAGTTAGAGC
AACAACAGTTTTTTGTCCCCCAGACAACTGCTTCATAGACTGTGTCTCTCCTTGCCCAGTAAAAGAGACCTGCAAAAAAGACCATTTTATTTGAGAATTCGGGATAGGTCGTCCTACTGA
ACAAGGTACAGATGGTTGGACATGCCTTCACTTTCACTCCAATGTATTTCTCAACCCTGCCTCCAGTATCTGCTTCTGGAGGTCCAGCTTCATCAGGATCATCATCATGCTGATCCCCGT
CCTGTGTAGTGAATGAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGATGTTGCACGAATTCATAAATAATCTAGCCGTAACCCTAGAACACCATTCAAACCC
ATAAATTTAAATTAAACCACAGATGGCACAGTATTCATACAAGTCTTGGAAGTGTTGTTGGCACAATGTCATACAAGTCTGGTTCTAGCTACAGGTCCTTCAAGATATTAGGGTGATGTT
ATCTGAGAAAATTGTTCAATAATTCAGCTTTTTTAGTCTGTGGTAAGAAAACGCATGCTTAGTTCATCTTTAGATCTGTTAATGAGTAACAAAACCACAGGCTCAGAGTTCTCGACCACT
CATGTCTGATGTGTATCCCTTCGACTATTCCTTGGGCTGGATATTTTGAAAGACGAATCAGATGATCCAATTTCCCCCTTCCTTATATTTATCCTCATTAGCTTAGAACCACTTCTGGCT
GTACAGCTCCGAAAAACTCCATGCAAGTATTAAAGAAGATTATTTTTTGGGCTCCACGAAAGGGTGAGCAGAGAAGAAACTCCTCCATAAAGCCACAATCTCTAGAACAAAACTAGTGAA
CACACAACACAAAAGCGAACAGGCAGCAGGAACAATATCCCCGGCCAAAAGAATATAACACAGCGATCCTACTATAACTAGAGAGTAAAACTTCCCCTTGACGATGGAAAACACCTACCT
ATCCAGTCATGTCTTCAAACAGAGATCTTGAAGGTCGGATCAGTCCTTCCTTTTTACCCTGTTTACTTGAAGCTGTATAAGAAGTTCCTTGACACATTCAATCAGTTCCTAACCTCCATT
AAAATTATGTCAAAACTTCTCAAGAGTCTTGTTGGTGGAGATTAGTTCAAGAACATAACTCAGGTCCTGTGGTTTAATGCTCTAAAAGCTCTTATGTTAAAAGTCAAGTTGGACAGAAAT
AGAAAACTGTCCCAGGAGAGGAAAGGCCCCTTAACAGAAATCAGAGGGCAATACTTAAGTTTCTTCTTTCTGGACATCCACTGAACATATTTGCAAATTGGTCCGGCAAAGATAATTGCC
TTGGAATTTTCTATGTATCAGTAAAAAGAAAACCTTTTCTTAATGAAAGAAACAAGGTCCACATGCCATAAAATGGCAACCATCTAACCACCTAACCAAAATGACTTGTGCTGTCATATC
TCAAACTAAGCCATTCCTCAGCAAAATACCCCACAAGGTCCATAACCACAAATATATAATATAAATGCATCCAACACAAACAGGAATGCGGGCAATACAATCACAATTGTACCTTTTTCT
TCATCATTACTAGATATCCATGGCCACCTTGAACAAGCTCTGAGAAAACTTCTCGAAAGTGCTTTGCAACTCCTTTGAATGTGCGTTCAATTGATTCGTCTTTCCTCTGATCTAATACTC
CTATGAGCTCTTGAATTTTCTACAAAGTCCAGAAGCATATTTTCTTGGAATGAGTTTGACACCAAAATTACAAACAAAGCAATCTGAATTGAATCTTATTCAGTGATACCTCATCACCCG
CATCCAATTCAGCTTGCCTTTTCTGAAGCTCTTCCCTCTGTTCTGTGAAATTCACATACTGATCCAATGCTTTCTTATTAACATGGCTGAATTGCTGCAGTTGTTCGTTGCATCTATGCA
ACATTTTATATAGTTCTTTGATGTTTCTCCTCTTATACCTAACAATTGTGGGAAAGAAAACATAACAAGGATCAGGTATCCACCAAGAAAATAAACTACAAACAATAGATCAAAGAACTG
AAAAGCATCTTCAAACAATACCAACTATGACCATTAATAATTTGTCGACAACTAAAAATATGACCAAAATCCAAATTCAAAGAAAAGGTTACGTTTCAAATGCATCGGATGGCAGTAGCC
CCAGATCCGTAATTTTCTTTGTATGCTCTTCTTCTTTGGCAAGAAGCACACTTCTTTTGCTTAATAATTGCTCCAATTCTTTAGCTTCGTCTTGAAGTGTCCTCTCGTAGTTGTCCTCTA
AAGTCTGCATTGAAAGGGGATCAACCAAGGAGCCAGGATAACAAGACCAACCAGTGGTTAATGTGTAAAATTGAGATACCTTTAGTTTATTCTTTTCATCTTTGATCTTTTTAATTTCCT
TAGATTTGTCGTCCATAGTTTCAGAAACTCCTGAGAAATCACATTGAAACCTCAAATCGCTATAAAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAAA
AAACCATAATGAATTTGCAAGATATTTGGAAGTTTCCAAATCAAAAGTCTCACTTTTGAGCTGTTGAGTTGCTTCCTCGACTAATAATTTGGCATCTTTAAGTTCCTGTCTCTTTAATTC
TGCTTCTCCCAGTAAAGAGTCTGCTTCTGCAGATGATATTATAGCTTCTAACTCTTGTTTCCGCCGCTTGAGGTTAGTTGTTAAATTTGTTTCAAGCTCAGCTTTCCTCGTTTCAGTCTA
CCCAATAAAGAAACACAAGCACAAAAATATGAGTTAATGAAATATGACACCAATATAAGCACGCACCAATATACAGACCTCAATACGTTCTGTCTTGCATGCAATAAGCTTCTCTTTCAG
CTCTGATATTTCAGGGTTCAGTCGTGATAGAAGATGTTTTTCCTCTGGTGTCAAATGGTCAATAAGATCTGTGCCCATTTCAGCTTGTTTCATGGCCATATTACCCCTAAGCTGGTCAAT
CTGATTCCGAACATCAGCAAGTGATTTTTCCTGCATACAAAAATAAGAAATATCAACAGAAGAACTATATTTTTTATCTAACCATAGTAGATTAATAAGTTACCTAGATCTAGTCCTAAA
GATACCTTATTCAAACGAGCCTTGGAAATTGATTGTTTCTGCTTCTGAGCATTAGCAATGTCCTGCTTAAGCTGTTCCAATTCTGATTTATCATGACCCAGCTTGGCATCAAGTTTCTGC
TGCTCTGAAACAAGTTCAGTAATTTTTCTGTCTATCTGTAAGATAAATTAAGTAAAGGAAGACGTATATGCAACCAAAAAAGTAGTATAACAAATAACACACAAACTGGAGTCAGAGTGT
CAAGTTTTAATAATTAAGAACATGTTTTCAGGATAATAATTAATAGGTTTTGCACAATATCTTATAAAAAATGTTCAATGCATAAATATCAAAAACTACTGCTCATGTCGATGAGTATTG
AGTTTCTTATCCTTATGAAGAAATTGATAAACTAGAGAATTCAATCAGGATACAAATGAAAAAACTACTTTTCTTTCTCCAATTATATTATGAAGAAAATACAAAAATCTTTAGATTGAC
ATTGAATCATTACTTTCAACAGAGCTTCCTTTTTCAGTAGTGAACAAACTTTTACTTGAGAAATCATAGTACAAGTACAAATGGAGAAACATCATGGTCTTTCATTCTAACCGTAAAAGT
GAGATGCATAAAGTACCAAAGCTGAATTGAACATTTGTATTAGCAAAAACTATAAATTTTCATCTAATAGTGAGCAAGGTGTTATTAGGCTAGTAGATTATTTTGACAAAATAATGAGGC
AGCTGCAGTATTGGATCTCACCCCGCCCCCCCTTGGTGACAGGATACAAAGTAAGGTTTCATCAAAACACCCAATAAAATCCATGGAATTCAATGCATTCTTTTACTATGTTATTTGGAC
TCAATCAAAATGAACTTGATCCATGGAATTTAAAGTCCTTGCTTTTCACAGGTGTCATATTGGAGGAAACAACAAAAAGGATATCTTGAAGTGCCGATCTAACTTTTGCCAGGTCATCTT
CCTTTATGTTAATGGCTTTGGTATTTTGCATAATCATATTCATAAACTTCAATTTTGAACGTCGGTGATCATAAAATCCCCCTGTCATACCACCTTTTTTGCTAACTTGGTCACCTATTA
CAGAGTCAAAGGAAACTTGTCAAAAGAAAAAAAAACATACATAGTAAAGCAATCATAAATTGGCAAAGTAAACTTCAACACCCACCCTCCAAAGTTATACAGTCCAAACCATCCGTACGA
GCAACTCTTGTAGCCACGTCTAAATCACGACAAATCACTGTTCTAGCAAACACCTGGTAAAATGTATAAAAATGAAAGTACGGGACAATAAGCACATTCATAAAAAATATTGCATGTCGC
TTACTTATTTGCATCAAGCTAAAATGAAAAGCTTAATAGTTGAGTATTTATCTCTCAAGTTCTACCTATTTGTGCAAGTTTTAATTACTAGGTGTATATCCCAAATTCAATTCATCTTCA
GTGACACAAAAGTTGAGCAACATTCTAGCCTAGTGTCCCGTGACATCTAGCCTGTAATAAAATGTATAAATCATGGTTAAGTTGTCAATCAACGCTAGAGGGGAATTTTCAGACTAAATA
GCAACCACAAAAGAACCATGTGCCAAACTGAACACTGGCAACTAGTCATTTTTCCTTCAAATAAAACACTGTTTTAAAAAATATTAATTATCACTTCAATTATTTCCTCGCTTTCTCACC
GGTTCTAGCTTCTGTAGGAGACTTATGCCTTAATATCAAGGGGCCTTGTCTTTCTTCTTCATTTCTCTTCGAAAAATTCCTCTCTACTACAAGTAATTCAGAATATGGATGGTTGACTAA
ATAAAGGCAAATACTGGGATATTTTGGAAGAGAATGGAATCTTCAGCTGTCGTGGTGAAGGTAAGTACTATATTGTTTTTGTTTTTCCTTGTTTTCTTTTGTTAAGGATCCCAATAACAA
TAATCAGCGGAACATCTATTTTCAATTCAAAAGCATTGGAATTGTTTCCACAGGATCATCATTTTTTTTCTAACAGTAATGAAACTGCTTCATAAAAACGTATGAATCACAAACCACTCC
TCCAAATATATGATGGTACTTGAAACTACCTGAGAAAAAGCTGGTGAAAAATTGGGAGAGAATTTTAATTTCTTCAACAACGGTATCACATCAGAACTCTGTGGATAACTAATTTGCGGA
GCTTTCACCCTGTTGAGTGGTATAAAAGTAACCCTTCCGCCTTTTGATGAATTAAGATGTCGTATGATCTGGGTTGATATTTCATCATTTTCAACCACCACATGAAATAAGCTGATAAGA
AAATGAAGAATACCAATCAAACCTTGATCTTTATTGAGGTGCACAACACACAACAAGGACACAATTTCTACATGTCAGCTGGTCAATTCAACTAAAAAACTGTGACCTAATGAAACCTTA
AAGTCAAAATATAACAGAAAAAAATTCATTCACCTGTTTCCAGCCGTAACTTCAACAGCGGTAAAGAACTTATCGTCACAATCCAGCAACTCAATTATTGGACCATGCACCCCAGAAATT
CTGTACTCTTTACAAATCCTCCGCACAGAATTGAGTCCCCTTCTTACATCCTAACAATATATCAAATAGAATATTGAGGAACTTGGATAAGAAATACACCATATATTCACCATACACAGT
ATTGCATAACTAATAGACAGAAGAAGAAAAGTAAACCAAAAAACGACAAAATAATAACCAATACTGCAGAAAACAAAACAAGAACTGATTGCCCGTGCCAATCCNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCAACGGCGAATAATTTCCTGTGCCAATCCTAGAAATCATGAACTTGAGTTTGTTCCT
AGCCTATTGCCATTGTGTATCCGAATTATTCAGATAAATCCTAAATCAAGGTATGCATGTGAGAAAAAATGGATGCGTAAAAAAAAGAATGTTGTATTACTTGAGTTTAGGGGCTACTTT
GACCCATGAGTAAGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGTTC
CCATGAGTAAGGGTATCAAAGAGCTACAAAGTTACTTAATTTGAGAACGAACTGACTAATTGGAAAGAGCGTTCTGGTGGTGGGCTGCACACTCTCAAATTCTCCCTCATTCTCTTTTTT
CAATCTAAGAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNTACTCTATGAACTACCAGTTTTTTTTAACTAATGAACTACCAGTTTGAATTCTATTACAGTAATATTAAAGCAACTGGATCCTTAGGGAATGGTGGCATACAAAAGATGAATC
ATTTCAAATCTCAGGGAGAATTTTGCTTTGAAGGAACAAATGAAGCAGATACATTAGGAAAAGAACCAATCAATGGAATGCAGCATAGGAATGTATGATAAAGAGGAGAACATGTTCCAA
CATGTATCATCAGTTTTACATGGCCTGGTGGAGAGGACAAAGTCAAAAAGGCCTAATAGGAACATCTTTTTGTGGCACCAACTATGATTGCAGAAAATAAAAGTCGGAGATGTCTATTTT
TCAGTGATCAAGAACCTAATGCATGGTTGTTTCAAGAAAGTAACTGAGGACCAAATGATTGGAAAAGTGCATAACTTTTGAAAGAGGATTAAGCTCAACAGAAACTACTGGGGCAGTTTC
ATCCATGGTACTAATGAATAGTGTTCCAGTCAAGGTTGGGATCTCCAGTCTCCCTTTCTTCTCCTTAACTCTCTATTCAACAAACTATCACTGAGTTCTATCAATTTTTTTCCAAAATAT
AATTAGTTTAGACACTAGAACTATCTAATTGTCCTGAGGTTGAAAACAATTTGAAATAGAAAGAAACGATGACAATAAAAATTCTCCCACCCTAAAGCTAAGACCAGTAGGAAAAGATGG
CATCAAGAATTTAACCAGTAACATTTTCTGTACTTGACATCATACAGATACCAGCATATTTTGATTTCATTCTCAATCAAAAGGAAAAGAGGAGGTGGGAAAAAAGTAATATTATCTTTA
ACGTCGAGACAATTTATGAACTAAAATTACACGAAAATCAGTTCTACTTCACCTTAAGTGACGGGTCATAAGTTACAACCAAGAATAGAAAACCAATTATATTTGACAACCAGCTGATAC
TATGATGGTTTAGTGCTGTAAACTGTCATTCATTTCAGAGGCTTTAGAGCATAATATGGCGGTATCCCACCACACTATTTTATCCATGTCTTGTAGATATGGTTTTCATAAGTATAACTA
GTAAGGTGATTCTTTCAAATAACAATTAAGTAGCTAAAAAATTATAAACTGATCTAAAAAGAAAAATAACAAGCCTCCTAATTAAGAAAATTTATTAATGAATATAGCTTAAGGTACAAA
ATAGGGAACAAAAAACTGACTTACACCAGGTGTAGCATGATCAAGACTTTTTTCTGCCTTCTCAACTTCAGCTTTCAACCTATCAATTTCAGCAACAAGTTCATTTTCCTTGCTCCACAG
CGACCTATACATTAATCAAGGCACTCAGAAAAGGATGAAAAACTGAACAATTAATTGTGCTATCCAGATACAAATATTAGTAACTTTAAAAAAACAGACATATGAGGGCATACTTCCGCT
CATCCTGTAGCTTGTCTCTCTGTGCCCTGAAGGCATTAAACCCATGGGACGACTCAGTTATGTGGGACTGTAAAGTTGTAATGTCCATTTTGCGCCTCTCAATAAAGGCATCTCTCTCAA
CTAACTCAGCATCAAGCTTACCAATTTCATCCTGAAGCTTCTGTTCCTGTTGTCGAAAAAGATGAAAATCTTTAAGCAAATTAGCAGAAATCCAAAGGCATTGAAGTGAGCAACCTCCCA
AGATGCTATCGTATCCTGAAACACCTTTATATTCCTTTAGGACCAAATATTTTCAAGATGGTGAAGAAATTTACTGGCAACAATACCTACCCTTCCCACGGAAAGAAGAATGGAACGAGG
TATCATACATCATAACACAAAAATACCTCGAATGAGCCATACAACTCTAAACCACAATAAACATCTATCCAAGATAGGGCCTCATAGTGAGAAATAAGGATTTACAAGAAAGAGTTACTA
AGGACTAAGTAGCCACATTCATTGATCCTTGACAGAGCAAGAGAAGATGGGTACCCATGTTAACATGAAAGCATCTGAAGGAAAAATTGTCGGAGAAAGGAGCACTAAAAGATGGAAAAA
AATAATAATCTAAACTTACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAACATTCAAGTACCAATCAACGACATTATCTAAAGGGTCCAAATAGTCTT
GCATCCTAAAACGTCCAAGCAAAGTGCTAAGAGATTATTTTCTTTCTCACACTACACTATCCTACTCTATTTCTAGTTTCCAATGCTTTCACCTCAAATGACAACTCCTTCTCAACCTCC
CTCTTTAAGAACAATCAGATTACATTAGTGTTACAAAAAATGGAACTAAAATGAGACTATGCTTCCTCAATACCACAAAGTAGTTCAATTTTCAATGGTAACGAGATGTCTAATATGAAG
CTATTGAATGCAGAACAAACTATTTGACACAAAATAACAGTGAAGCTCCTTCAGAAATTGACAAAATGGTAATATTACCTGCCCTATATTTGAAGATAACACTCGTTCGTATTCATCAAT
CTCCTTCTGAAGCCACCTGTCACGAGCAGCTTTACTTGCAAATTGGGTGGCACGACCTTGTTTTTGATAAAGAATACTGAGCTGTTTTTCCCGCTCCATTATTCTACAAAATTCATGAGA
TGTGCCAAGGTGCAACAACTTAGCTACAGAAACAATTATGCAAGTGTTGACTTGATATTTGAGTCGAATTGAGCCATTAACTAGAATTGGAAATAGAAAATGCAAGAACTACATATAAAC
TCAATGGCATCAAAGTTACTAAACCCTAATTTATTATCTCTCCTCTCTCTCCTTTTCTTTCTTATTCTTTTTCATAGGGTAGGGTTCAAAAACAGGAAAGGGAACTTAATTGAAGCACTA
GAAGAATCTCATAGACAAACCCTTTCGATATTTCCTTCTCCTCTACGATTTGATTGTCATAAATTGGACTTATTTTGTCGAGCTCAACAGAAGAATCTTGAATTTCTTTTTGTAGCATCT
GAAGCTGCCTCCCTGCATCCTCCTGGAAGCATGTTGAAATATATCAAAAAAAAAAAAAAGAATGATTGTATGGATATTATAAGTGGAAGGATGACACTGAAAAGTTATAGAAGAAAGATC
TTCTCGTAATAATAATACCTTAGCCCTCGTATTTCCAGAGATCTTCTCTTCAAGATCTTTGACATCAAGTTCAAGCTCGGTGCGCCTTTTTATAACTTCTGTTCGCCTCTTCTCCACTGC
CTCTTTTTCTTTAACTAAACCTTGAATTTCCTTGGTCAACTCTTTCAATTTTTTGTCGAAGTCCTTGGATCTTTCATGAGCATCTAGAACACTATTGTACATTTTAGTTGACGTTTCAGA
AACCTTGGCTCGTGCTTCATCTACCTGAGTATAGTTAAATTTTGAAGTTTTAGCGTCATTACATGTACATGCAAATGACAAATGTCAAGCAGATTAACATAGAGACCACATTTTCAAGGA
ATAGAAAACCAAGGGATTCTAAACCACTCAACAATCCCCAAAGAAAGAAAGAATGAAACAGTGGAAGGGGAAAAGGATCATGGTAATAAGTCGATAAGCATTAGTTCATATTTCTTTGAA
TCTAAAGAAACTTATTGACAACATAGATGACCCTATATACTATACAGTATTTCTTTAGAAAAATCACAAAAAAATAAATAAATAATGCCTTCAGGGCAGCTAGACACATCATCCACTTGA
CTGGTGTACATTCTGAATCCATGTGAACATGTATCAGTCAAGTAAATTGCTTCCCACAAGTCACACCATGAATGAAAAATAAAATACAGACCAACAAGGTCCATTCCAATTCAAAGTTAA
AGGACAGCTAAACCTCCAACAGTTTCTGACGAGTATCATGAACTTCTTTGTCATAAATAGTGAACTCTAGGGCTTTTCGCTGCTTATCCAACTGCTGATATTTTCTAAGTTCTTCTTTTT
CTTCATCAAGTTCTCTCAATCTCTCATCAAGATACTGAACAACTTGAATGATCTGCTTTCTTTTATTGCCTGATAAGCAAAGAGGAAGCGAACACAATTAAGTGTCAAAAACATCACTTG
GTTTATAATAACATGGTGAAGACGTACTGGTTTCATGCATTATTTTCAAACTTTCCCGCCTTCTCTCCTCATAAACTCGAGTACCACCAATTTCCTTGAGTAAATCTAATCGCTCAGAGT
CCTTCATCAATGTCAATGATGCTATCTGTGCACAATTAGAAAAAGAACAAATGGACATTGAATTATAGGAAATAAGATCAACATTACACCTTACATTTAACATATAATGAAGTTCAAATA
TACACCTACCTTTCCTTGTTGCACAACATAGTAAGGATTTGAGCGAGAAAATCCAGCACTTTCCAATAAATTCATAACTTCTGTTTTCCTAAAAACCATTATTGATCAAGTCATAAACAG
ATACTGTGAGAAATCTTCAGAAATCGATAGGGAGGGAAATGAGAAAAATGGAAAGTTACTAACGTGATATGTTTCCCGTCTAAGAAATACTCATCCTTTTTCAGCCCAATCGTTCGACGC
AAGCGCACCTCTTCCTTGTCTACCTTAAGAAAACAAAAATACATGTATAACACATCAGTTAATAATTTGGCTGGAAGTGCAAATGTTTAGTTTGCAATACCATAAAACGGTGGAGAATGA
GATGTCCTGCAAAATATAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAATACATACATGCAGACAAAACCACGAGGGAAAAAAAATATAATTCTGGATG
GGGAAAATACAGATTCATAAAAGTTCAAAAAAAAGATAAGCCTATGGAAACTTGTAAATAGAAAACATTTACAAACCCAGAAAGTATCTAATTCGTTAAACTAGCTGCAGACAAGATTTT
TTTCATATATGTAGGAAACAGCTGCAGACAAGTATAAATAGAAGGCCAACAGAAAAGGCAGTTTTTTTTTGTCACAAACAATATGTATCAATAATACAATTCCACACATATAATAGATAA
ATAACGTTTGTACAAGAGAGGATAACAGGAAGAAAAAACTTACTGGTATACGGTTATCCGTATTATCAAACACGATTTCCACAAAAGCAGTTAAAACTTGGTGCCCTGCACCTTCCTGTA
AGAAATTTATCACAAAATATGTAAATTAGATAATGAAAGAAATCTATAGTCAAAATTAAAATATTTATTAGATTTAGAATATGTAAACACATACGTGGAGCAAAGCATGCCTATCTTCAC
TCCTCAAATTTTGGAAAAGGTCGCTCAGTACAAACCGTATAGCTATTCAGACCACATAAATAAGTTAACAACCACCGTCATCTTATAGCATAAAAACTACCAGAAACTGAAAGATAAATA
GGAACAAGAATGATGATGCTCTTACCATGGAAAAAGTTAGTCTTGCCAGATCCATTCGCACCAACTGCAAAATATGTTCAACAGGAAGATAAAATGTTCATAAATGACAATTCAAGAAGT
ACCGTTAAATTATTGGAGCCTCAAAATTTGGTGAAGGAGTTCTTAATTTCCAAGCAAATGAGAAGATTTTCCAAACAAATTTGAAGGAAATGTTCGTTTCCATAAATAACATTTTCATGA
TTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTTCTTTTTCTTAAAGGTTTTGTAATCTTTCTTTTTTTTCCCTCAATGCAAGCACTTAGTTCTAAGAAAAAAAATGAAAAAGATATAATAT
GAATCTAATAAAGTGTCAATGACAGATGACGTGACTAAATGATGAATAGAAGTACTGGAAAATCTTCTCGGTAGGCATTTGTGAAGTCAAGAAAATTAAAAATAAAATGCAGGTTGTCAG
GTATCACTCGTGTGGACGGTAATGCCATTAGAAAAGGAGCAACAAGCATTTGAGACCATGCTGAATAGAATCCGGAACCAGTTCATTCATAAAAAACGCCAAAGTGATAAAACTTTAAAT
AAATGTAAGCAAACACCGAAGGTTATTGTGTCCTTACCAACACAGTTTATTTTTGGACTGAAAGGCTCGGTGGCAACTTGTTCTCTATAACTCTTAAACCCTTCAATAATAACCTAAAAG
AGAACTTGATGGTCATTTCCATGTATAAAGGGCCAAAAATATAACGATACGATAATAATGTTAGGCAAAAAGACACACGATAGATCGAGTATTAATCACCTGCTTTATGTGCATCTTGCA
GCGGCCGACTACTCGATTTCTATTAGACAAACGGGGAAAATATTAGTAACTATTACATCGATTACTCAGAAAACATTTGTAGAACGAGCTTGAAACTAATACTGTGTCCACCGAAATGGA
ATAAACCAAGCAACAACAAGCTACATCAATGCAGCAGGAGTACTGACACGCAGAAAAAACCAACGCCAAAGCAACCATGGAATTAGAAGACAAACCAGTCAAATCGGTAATGTAGGGTTC
AGTCGTAAATCAACTTGAATTTCCAGACGAATTCACTTGCATCAGGAAACGTCGAGCTCTTGAACAGGTTGAAAACAGAAGAACCGTGCTGCGAATTACTAGTTTGAGGCAACAATAAGA
GTTGAGATACGACAAGAGAGTGAAATGGAGAAGTTTCTGGTGGTGATATACATAATAAATTAGAGTAGAAGAATTGGGTGGTAGAGAAGTGAGAGAGTGGAGCGAATCAAATTATGAAGT
TACCTTATGATTTCTCAGATTAGGGCGTGGGAGAAATGTACTGAGGGCCGTGGCGAAGTAGAGAGCGTATAGATTCAATTGGGGGAAGGGAAGGCGCGAAGAGCAAAAGGCGGCAAATCG
AGAGCTGCCGGAATTCGTTGTAATTTCGTGTGTGTGCGTGTGTTGAGCGAACCGAAGCTATTGACCGGTTTTAATGAGCCGTGATTACACAACTTTCGGAGTTAATTTTATTGGATTTTC
ATTTGTATTGGGTGAGAAAGAGAAAAAAAGCTCTGTTGTGATTGATTTTTTGTCGAGCTAATTAGCATCGTTGGTAGGACGAGCTAGTTAAATCCGGTTATGGATTTTAGTAACCAACCA
CAAGGTTACCGGGAAAGTCCGTTTTCAAGGGTTAGAAATTAAAATTAGTGATGTTTGGTCTTTTCCACGGATAATCATTTTATGAAATTACACTTTAACTANNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCAACTTCCTTGTCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTGTCATCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGGTCGTTCATACAAAAAAAAAATCAAGTTGTAGCAAACAAAAAAGAGAAGAAAA
AAATTGAAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTACGTACATGATCTAGTAAAGAAAAATGAAATAGTCCAAGGA
AACCACTATGGCACAACACCAAAATTACGTATATGATCTAGTCAAAAATAATAATAATACTTCATGTCAAATTAAACAATTCTATCACATCAATATCACAAGATCAATATGATCTACATG
ATCTAGTCGAAAAGAATAATAATACTTCATGTCAAATTAGATAATTTTATCACATCAATATGATCGGGTTCTATAAAACAAAAGACAAGGGAAAGAAATATCGNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNCTAGGAGTTGTGAAAGTAGTGTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTGGTATGCTTACTTTTTAAAACNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTTTTTTCAAATACAATAAAAAAAATGCATTTCTTTTGTTTT
TCCCTAAATCTTGTGATTTTCAAAATAATTATTGGATCACAGGCTATGACTATCGATTTTGTCATTTATTAAACATTGGGAATGATCCTTGTTCTATAAGACCGATTGGTTTATGGTTGA
CATCAATCCAAGAAAACTGAATGAACTATTTATTATTCCAAGATGTATCAAAGTATCATTTATCAAATATTGCATTGTCATCGTAAAGTCAAAGCCATAGCATGACAAGGTGAGACACAA
AACAATAAAGGAAAAATGTTCACTATATATGGCATTAATAAAAAAAATATAAGAAGATATCAAATTAAATACAATTAAACTTGCAACGTCAAAGATTAAATTCTAATAATTTAAACCTTT
CGAATAGGTAGTTGCATATCATATTTTCGATGGGTTCATTTTTTTTTGTTCATATATGGTACAATTGATAAAAATACAAATTTGAAAAACAAATTAAATGAAAGAAAAAAAAACATATGA
TTAGATAGATAATTAGATCTAAAGTCTAAAGAAAATGGGTCCACCTTAACTATCGTTCTAACCACAACACCCGTTCCCAAATATAACATTGACTCGAAACATTGGTGATAAGATACGATT
CCAATGGCTGCTTATCTTCCTCCTACAACACCATTCTCGCGCCCCAACATTAGAATCCTCACTTCCATCTCTTCCTTCAACGTTTCCAACACTCTGACCACTCGTTCACAACCGCGAAGC
ATCGTGAAATGCGAATCCAGTGCATCGCCAGCAGACGGCCAGACGCCGCCGCCAAAAAGTCAGAAACTCGAGATCGGGTCCCCCGTTATCGTAATCGAGGCTCCCAAGATGATAAAGACC
GCAGCCTCAGTTCCATGTCTCAGGGTCAATTCCGGCATAATCAACCCCGGCGACGTCGGCAGGTGATTACCCAATTGCCACTCGTCCTCTGTCTTTAACATTTCATCGAACACATTACGT
GCATCGTTTTCTTTTTTTGGTAACTAAGTACTGTCTGTTCCGTTGCTTTATCGTGTGTGGTTGAACAGAATCGTGTCGAGAAAACCTAAGGACGTGTGGGCCGTGCGGCTTAAGGTCGGG
ACTTACCTCATAGATGGAAGGTATTTTAGAGCATTAGAACTCGATCAATAGCTTTAACTTGTCCGGAGAGGCTTTCGATTTGAAGGTTCCGAGCTTACAAATTCACCTTTCATGGCGATT
TCGTTGGAATGCGGCGTGTGTTTGAATCCATTTGTAGGAAATCATTCCGTTATCGTTGCATGTTGTTCAGATCACCCTCCATGTCTCTATCTTGATGCAGCAGATTGAATGCAGCTTGAT
TAGCCATGAATTTAGGAGTCTTATGTGCATAGTTTATTCCTTACGAATAAATTTTCGATTCTATAACATATATTTTACTGCAAATTTGTTATGCATCTTCGTGGAATTCACGATGCAACT
CGAACCCTCAATCCCGTTTGATGGTTTCTTTGTTGCATGTTTCCATTGTATTTTAAGCATGGATATAATTTTTGGTTTACCATGATGTATTAATATATTAATATAGAGATCGGTTGGTTC
AAATTAGCATGAAATTAAAAATAACTATGTACACATGGAGCAATATATGTGTATGAAATTAAAAGTAACTATATACATATGGAGCAAACATACGTGTTTGTGTGTCACGTCAAATTGTTT
AAATATAGTTTTTTGTTTATTGCCAGCGATGAGAATATAAATGTAGAATTTCAAATTGAACTTAACATTATCGTCTTTCGTAAGAAACATTTTCCTTTGAAATACCATTGTCTTTTTACG
ATTCATTATATAATATTCGAGCATTTGACATTTAGATCGTGTGGGCAACGTCTCAATCAAATGTATGTTCAAATCGTTGTTATTCAAGTCATGAGTAATCATTTATCTATAGCCCAACTA
GCACGAGTTATATGCAGTTGAGAATTGAGTTCTATGTTGAAATTTTATTACTCTAACTGGTGCATCGTAATGTTATTTCCGTTGAAGTTTGATGTGTCTTAATGTTATTTGTTTGTCTAG
CTTCAAACGGGTGCATTGTAAGCTATATGCAAGATAAAAATCTACTAAATCCAAAATTACACTAAAACGCTCTTACGTACTTGTAACGTCACTCTACAAATATTATTTAGTATGAACTTT
GAATGTGGTTTTAGTTTATCTTCGTTAACAAGTTGCTTGTTGCTTGAAACCTATAATTAGAAAATTGCATACAAATGTTAAGCTTATATGACATATTCATCCAATAACAAAACTACCAAA
AGAGATAAATCAAAAGTTTATCCTGATCTTGAGCTTCACTTTTACAACATAAAGATATATATACATTAAAACAAGATTACGTAAACNNNNNNNNNNNNNNNNNNNNNNNGCTAACAAAAT
TAAAAAGTACACAAACCAAAGTAGAATATTAAAATTGTTGGAATGAAAAATTAATCAAAAGCACAAGCAAAAAAACACAAGGATTAGTTTGAATTTTAAGCTTTATGATGCGGTAATTTA
TTGAAAAAGCAAGGTTAAGGTCATGGAGTAGATGCAAATGTAACCAAATGAAAAATATTTAACAAACACAACACAATGTAAAGGTTTTAAAGATATAATATAATTTACATTCAACATTTG
AAACCCTATTGATAGAAGAGTGTATTTCGTTTTTTCTACCAGATTGACAAGGTATCAATTGTTGACTTGCTGTACATACCAATGCAAGATGAAGCATCGATTGTAACCAACGATGCCACA
ATTACACGTATGAAGGTAAAACTTAAAATGTTGAGATGAACACACTATAGTTGACAAAGACTTTATTTATTTATTTAACTGACTTAAAAATTGTATGAAAGTTTCAAAGTAGTCTATGTG
ACTGTATTAGCAGTTTTTGCAACGTTTGTAAAAGTTGCAGACGATGTCGATGTTGGCAAAAGATAAACTATTGGAGAATTATTGAAGAATCTAGCTACATGTGTGTTTTTCATCAGTATG
AGCTGGAAAGTGCATTAATGAACTTTGATATTGATTAGGCAACATTGTGATGTACCATGGTCAAATGATATGTAAGATAGCATGTACACTTTTGGATATCATGTTATGTATTATTTGTTT
TATTGTATGTCTAGTGAACTTTAGCTAGCTAGAGTAAACAAGTTAAAGTTAATATATCAAGCGAGGCTGGTCTCTTTTTTCTATATGCTCCTTTACACAAAATATTTTGCATTAGACCAC
GTAAACTCAAATGGATTGCAAACGCACTAAACAAACACTTCAAACAGATATTTACCTAACTAATATACATTGTCTACATGGATTCCATCCTTCTCAACTAACGGATATTCTAAAATATTA
ATGAATGTGAAAATTTTGAGCATTCAAACTACATCTTTAAGTGATGAACATAAATGGTACATAAAGAGCTTTCAAGAGGAAGACCAACCCTAACAAAGCTACAAGTTCGGTTACTGGAAA
GGACTTTCATCACTCATACAAGTCTCGATACAGCTTATTACGACGAATAGATTTGACTATATTTACGATAATTAAAAAAATGTTGGTAACGTATTTAATGATGATAGACTTAGAAAAAGG
TAGTAATTAAAAGGTGGAGCCCATGATAGTGTTAAAGTGAGAATGGGCCGAAGGACAGGGGAAGAGGTACAATAGGCCCAAAAGTGAGAGGAAGAGAGGTTTGATGGTATGGCGAGCAAT
GCCCCCTTGGAAGTAAGATGAACGAAATTCCAAAAGTGCCCATTATATATAATGAGGAAGTGACATTCCTCGTTTAGCACTTCGCTCTCATTTTGGTTTTTTCTTTTCTTTTTCCCCCAC
CCCTAACTCTCTCTTCCAAGGCTGCAGAGACCATGACTGTGATGACTCCCGCTCCCGTCGATGTAAACTTTCTATCTCCAAACCTCTCTCCTANNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNCTCTCTCCCTCTGCAATTCATATGTAAACACCATAGTTTCTTGCGAGCTCACTCACTCAATCTCTTGTTTCNNNNNNNNNNNNNNNNNNNNATTGTAATTTCAAGTATCAATCT
TAATTTCATTGTCTGCAACTTGCCTGCTTTTCATCATTTTTTGACTCTTATTGCTCGCTAATCTAGGGCTTTGCGCTCAATTTCTGTGTTTCATCTCATTCCGGTGCAATTTTGTTCTTG
TTGTTGCCGACTGCCGCGTCTGGATTTTACAAGATATCTGAACTAATCAAGATTTTGTATCGTGGATCCGATTCCTATTTTTAATTTCTGCTTCTACTTTTTTTCATTCACAGCAACAAG
AGGACGAGGAGATGCTTGTTCCGCACTCGGATTTGGCGGAGAATAATCATCAACCTATGGAAGGTTTACTTTCTTCACATTTGATCTGTGCAATTATCTCTCCTAACTAATCGAATGCTT
TTGTCTTGCCTATTGATCTAATTGAATTATTTCGGTGTTTGAGATCATTTCTTGGCTGTACGGTTTACTCAAAGAATCTGGAAATGTTTAGCACAAGCAATTTCGCTACTGTCGAACTTG
TTTGTTTTTCTTTTCGCCAGGATATCTTGTTGNNNNNNNNNNNNNNNNNNNNNNNCCCCTTAAGAGTTACTACTACATATGATAGACGAAGGTATTCATTGGCATATCAACTGCTACTTT
TGGGAATTTACTTGCTCGGACAAATTAGTTTGTTGTTTCCCTGTCGGAATTAAATTGGAGGTGGTTGTGCTCTTTTTGATTTTTTCCTGTTTTAAATAAGTCTGAAAATGCGTTCACAGT
TCAAGTGTTGTATAAGGAGATTTTAAAGAAGTTTTTCGTTTCTTGTTCCTCTCCCCCTCTGCAAACCATCAGTTGTTCCACAATCGGAAACAGGAAACACAGTAGAGAATCAGCCCGTCG
AGGATCCCCCATCGTCAAGATTTACATGGAGAATTGATAACTTCACGAGGCTCAACATAAAGAAGCTATATTCTGAAATCTTTATTGTTGGCGGATACAAATGGTATATATCCCTTTTGA
TGCTAGTCTTTTAAGTCAATACATATGTTATATATCTACGGACTACGTGCACATGTTTCTATATATATACGTGTGCATATTTTCTCACCAAGTAAATCCTCTTTTGGCTAGGCGAATTCT
TATTTTCCCAAAAGGAAACAATGTAGATCATCTGTCTATGTATTTGGATGTTGCGGATTCTGCAAGTTTGCCATATGGGTGGAGCAGATATGCTCAATTCAGCTTGGGTGTCATCAATCA
AATCCATAATAAATATTCAGTGAGAAAAGGTACGTTCTCAGTACTTAATTATTTTGGACTAATTTTTTGGCTATCTTGAGGGTTATATACTATGATTATGTCGATCTTTATTATATTTTT
TAGACATTGGATGCATTTTTATGTCTAACTGTAAGCAAGACAAGAAGATAATGCGATCTTTCTGTAGCTGTGAAAGCAAATATAAAATTTATACAGCCTTTATGGCTGGAATGACTTCCT
ATTGTTGTCAGGAACTTAGGTTTCTTTTATTACTGCTATAAGTTTTGGCCTTTCACCCCTGTTTTGAATCACCCTGTTATGGTCAAGGACTCTGGATGNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNCCGGTGGGAACATCTTTATCAGTGAATAGATATTTCTGTGACACGATTCTACGGAATAATTGCAGATACTCAACATCAGTTCAATGCCAGGGAAAGCGATTGGGGCTTCA
CGTCGTTCATGCCCCTCAGCGAACTGTATGACCCTACAAGAGGATATCTTGTTAATGATACCTTAATAGTTGAAGCTGAGGTCCTTGTTCGAAGAGTGGTCGATTATTGGACATATGATT
CAAAGAAAGAGACAGGTTTTGTTGGTCTTAAAAATCAAGGAGCAACATGTTATATGAATTCACTTCTTCAAACTCTTTACCACATTCCATATTTCCGGAAGGTGGGTTATTGTGCCGTTT
CTTCTCATCCTCACATTATTTTCCAGCTATAGAATGAAATCAATGAAATTGAATAACCATTTTTATGCACAATGTTTTTGCTAATGAAATTGATGTACCATCTGCATTCCTCCTTCCTTC
ACGTGACATAAAAATCTAACTTGACATCCTAAATAAGTTAGTGTTTGAACTATTATTTCAGGCCGTGTACCATATGCCTACTACAGAAAATGATATGCCATCTGCGAGCATCCCTTTAGC
TCTGCAGAGCTTATTTTACAAGCTTCAATACAGTGACAGTAGTGTAGCAACAAAAGAACTTACCAAATCTTTTGGATGGGACACATATGATTCTTTTATGCAGCATGATGTCCAGGAACT
GAATAGGGTTTTATCTGAAAAACTTGAAGATAAAATGAAGGTAAACAATATGGCCATGCTTCTCAAGCCTTCCTTATAGCAAAGAAGATTTGAGCTGCCATGAAGAATTTTTATGATTGA
ATGATAATGATTTATATTAATATGAATACTTTATTCATGTATACAGGGAACTGTCGTGGAGGGAACCATACAAAAATTGTTTGAAGGGCATCATATGAATTACATTGAATGTATAAACGT
GGACTATAAGTCAACAAGAAAGGAATCGTTTTATGGTAATTACTTTTGGGTTATGAATCAATATGAGTATGCTACCTCCTTTATTATTGGCTGAAAGTGGCAATTCCTTTCTAATGTTTT
GATTTCAGATCTTCAGCTCGATGTCAAGGGCTGTCGTGATGTGTATGCTTCTTTTGACAAGTATGTAGAAGTAGAACGCCTTGAGGGTGATAATAAGTATCATGCTGAACAGTATGGATT
GCAGGTTGGTTGGAAATTAATTTTATGGGACATGGACAATTTTTATCTGTCCAGTTCAATTAACTTATTTTAATTAGATAAGCAAATTCTTACATTTGGCTAGTTATCGGGTAGTTTTAG
CGACTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGGAACACTTGTATCCAATATTTTTAAAAAAGAACATATATGCCAAATTGTGTATCAGATAGTATCTAAG
AAGTATATGAGAGTACAAATATTTTATGTGTAGAATATGCAAGGGCAAGAGTTTTGGAACAGTGTTAAGCTTTATTGAATCTGATACTGATTCAATACCTCACATGCAGTATCTATGCTT
CATGGGCGACTTTTATGTGGTTTTTGTTTCCCTGTTCTATTTAATATTTTATGCTATTCTTCATTTACACATTCCCAGATTCAGACTGCCAATGAATAGTTTTGGTCTTTAGTCTTGGGT
TTTCTTATATATTATAACATATTGTATTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGAATGTGGAGGTCATATAATAAGGGTTTTCAT
ACTGAAAATTGCTTGGATATCTTGAGCTTGATTTGAATGTGGAGGACAAACAAGGGGCATACATGTTTAGATTTTTGTAGTTAGGCTTTGATTTGGTGTCACCCTTTTCAGCTCCAAGTG
TTTCATATTCGGAAGCCAATAATTTCAAGTTGACTGTGGAGACCACCAGATTAGGGTTTAAATATAGTATAATAGTCATATTGCAATGTATGACAACCAGTTCAATAATTTTTTCTTGTC
ACCATCCGATCCGATTGTACTGTAACTCGCCGCAGCTCTGTTGTTTGTATGAGAATATAGGATATCACAATGCTGATTTGGATACTGGATTGCATAAGTATTAGTGGGTGTGTAGGTGGT
TGGATTTGACGTCTACTCGGAGAAGCTACACTAGGCATTGAAGCTTTACTTGAGGTTAATTTTGAAATTGAGTTTGGGGAGCAGGATCTGTGGGAAGGAACACAGAACATAGTAGTTATA
TTACAATGTGGTAATAGAAAAAAGAACAGAGCCAGAGGGCAACCTAAGAACAAATGGATATTTCAGTATTTCATTACCATTCCGGCAAAGATGCATCTTCGAACAAAAATTGGATACTTG
TACGAGTGTTAGACGTTCTAGTTGATTTTTTTTCCAACCTTTGCTTCCAAATAAAGAAATTAACTGGGAAATTTTGGGTTGTATCAGACACTATGGCAGAAAGAACATGTGATTATGTGA
TGAATTGGTTATCTTCTGCTGGTGTTCCAGATTAGTCAACACAAACAGTTTTCGTACAAATGAAAAGTCTGCCCTTCGCCGATGTCTTTGATGAGACTTAGTGATTTGTGGAGTTCCCGT
TGTGTTATTTTGGAGTTCACTTTGGTTTGGAAGCTCTCGTTGTGTTATTTTGGTTCTCAGAAGGGGCAAGAGTTTTGGAACAGTGAATTGGTCTTTAAATATTTTCACTGTTAATCTCTT
TTTTTGATTGCATTTGTCTCTAATTCTTTTGTTTTAGATTTTTTCTTTAATTTCACCCTTTTAGAAGTTTGTATCACTTGAAGATTTTTTCTCTTTTATTTTAACACGATAAGTTGTTTC
TTGTTAAACAAGTAAAGAAATTATGTTGCGAAGCTTCCCTAGTAGGTACGATCTTCTATAAACGAAAACAAATTTCATTAGGAGAAAGTAAAGTGCAAAAATAAGGGCGGCTGCCCTGCG
GCTTGCCTAGCCTGGATCAAGCAGCCAAATCTTCCCCTTCTCCACTATCTTTTAAATGAGATATTGTACTGGCACTTCCGTTTTGTTATTATTTTGAATTTTGAACAGGGACATGTAGTA
TGATATTATAGGAAGACGAGCATTGAGGTTATTTGATCTTCATCCGAAGAGAGTGGGTCTTTCATGTTTAATTTCTGATTCTAAGAAATTATGATGTTTGGATTTCCCCTTGTTGTGGGT
TGGAAATGAGAAAACGTGTTCTTTTTGGTGATGCTAGATGTTGTGTGGTTTTTGTGTCAAAATCTTGTTGTGGAGCTCTTTGATAGCATGCAAGTTTTGGAGAGTGACATGGAATAGTAT
TAGTATCGATGATTATGCTTTCTTGAATTGCTTTTCGTGATTTCAGATTGTCATCCTATGTAAAGTTCTTTCCTTCGTTTCATTTACTGAGGTTTTCCCATCTGAAATTTCCTATACAGG
ATGCCAAGAAGGGCGTATTGTTCATTGACTTCCCCCCTGTTCTTCAACTCCAGTTAAAACGATTTGAGTATGACTTCATGCGAGACACTATGGTAAAGGTCAGTATCAAAATATGGTTAT
CTTACTGTCATTCTTTTAACCGTTCTTCCAGGGACTGAACAATTATGAAAAGTCACAATTGACTGCATGGATAGATCTAATAATTATAGGATATTGACCTTTCTTGTTGCTGACTGGTAT
AAGCAGTTAAATTGTAACTTTGTGTCTGATACTGTAGATCAATGATCGATATGAATTTCCCCTTCAACTTGACCTTGATCGAGAAAATGGGAAGTATTTATCACCGGAAGCTGATAAAAC
CGTGCGGAATCTTTACACTCTCCATAGGTACAATGGATGCCTAATTATTCGCTCATATGGAGTCAAAGACTATATCTGTGTGAATGGGCCTATTGCCTACCAACTACTTATGATTAGCTT
TTGAAAATTTGAAGTCTGCTTGGTTCTTTCTGTTCTTTTTCTCTCTCTCTTTTTTTTCCCAAATAAACAACTAAACAGTTAGTTGCTTAAACTTTTAGCTTAAATTTTGGCAGTTATTTA
TTTTTATTTTTCAAGTTGGAGGAATAAAGGTCTCTTCCCACTCTTCTTTTGTTTCCTTAGAAATCAAGGACAGCCACTGATAGATTGGAAACGTTTTTTTTAAGAATAACGCATACACCA
CTGATAGATTGGTTCTAAGGTCCACATTTGTGCATTCTTTTCTTCCAAGGAAGTTCCTTTGTAAGAACATCAACTTTAGGCCATCCTTTTTCCTCTTTCTAGTTGTTTTATTCCTTAAGT
TTGAAAATGTTATATCTCCGATGAGATGTATGTGTTTTATGTGCACTGAAGAACGATACAAGTGAATGAAATCAGTAGAGGTCTTCATGTTAGAAGATGCTGTATGAGTGAACTTGGTAG
ATGCATGATGATCAAATTTAAAAGGAACAAAAATGATAAAAGCAAATCACCTCGTCCGTTTTGTTTTTATTTCAATTGGTCAAAAACAAATAAAATGTTCTGTTGGGTAATTATGTGAGC
TAATTTGAATTTTGTGGATGGTATTTGTATGCTTTCATAATTATATCACAGTTCATCATCTTATCCTTGGAAATCTCTCTGTAAATCTTTATTCAGTTCATTTGTAGAGTATGTTATACA
GTTAATAATCTTTCTCTTTTGGGTCCAGTGTCTTGGTTCACAGTGGTGGGGTGCATGGTGGACATTATTATGCCTTTATCAGGCCGACCCTCTCCGAGCAATGGTATTTTGTGGACTTAT
GATCCAGTCCATTCTTGATTTGCATTTGGCACTTGTCCATTTTAATATCTACACTAATTTGCATTGCTGGACTGACTCAACTATAAGAAATTTCTACATTGTGAAAGGGAACCAAAACTA
TGGAAGTTTGTAATGGTGTTTTGATTATGTGGTAAATATAAACTGCATCTGGTCACCTTTTTGGTATAACTTACTCATCAAGATTTTATACCTGCCACAGTCCTTAAGGGGCTGCTCGAT
CTGTTGCAGCCATGCCTATACATAAATAAAATATCGAAGTTTTAGTTTCGACCCTTGTAATAATCTTCAAATTGAGAAGTGATTGGGGCAGGTTCCTATCATGATGTCCAAGATTACTAT
TGAAGAGTTTGAAAAGAAGAATTTATCACTAGAGATGAAAGACAGAAAAGTTTGTGGAACTTTGAACAAATTTTTAGATTTCTTTTTGTAACAAACTCTCATCACCATCAATCTTTTCCA
GTGAGGAAAGACAGAAAAATTAGTGGAACTTTGAACAAATTTTTGGATTTCTTTTCGTAACAAACCCTATCACCATCTGTTTCCTTTAACAAAAAACAAACCTTCATCAGGTTAATTTGT
GTTTCTCTAATGTTACACAAACTTTTGGGCTCAGGTACAAATTTGATGATGAGCGGGTAACAAAAGAAGATGTAAAAAGGGCACTAGAGGAGCAATATGGCGGTGAGGAAGAGGTATTAT
TTCCATGTGAATATTTTCATTAGACTTTAATTTGAGATACACATGTTTCTGCTTATGATATTCTATCTGGTGGTTAACAGTTACCTCAGACGAATCCTGGATTCAACAACACTCCTTTTA
AGTTTACCAAATACTCAAATGCATACATGCTCGTGTACATACGTGAAAGTGACAAAGACAAAGTAATTTGCAACGTGGATGAGAAGGACATTGCCGAACATCTCAGGGTATGGTGCTGTT
GTTGCATGCTTCTTAGGCGTGATATCAGACAAATGCTAGCCAAGTAGTAGGATACTTGGTTTGGAAACTAATTAAAGGATTTTGAGCTTCACTTCTTTATCTAGTAAGGATCTGATGCAT
GACAGATCTTCTTGGTTACGTTATCTAGTAAGGATCTGAAGTATAACAGGTCCAATCTCGAGTATTTAGGTCACTCAACCCAAGAGGTTCATAGAAAAATATTGGAAAAAATATGGGTTG
AAGTAATTGGTATCCAAAAGTTATCTCCTACTCTTTTCCTGCTTGTTTTTGTGTTAGTGATTCAACTACGTTTACATGAACTACCTCAGGAAAGGTTAAAGAAAGAGCAAGAGGAAAAAG
AACACAAGAAGAAAGAAAAGGCAGAGGCACACCTCTATACTATCATAAAGGTTTGGAGTGTAATCATCCTTCCACTAGTTTGCAAGTGGCTGTCAATCATAAGTTATTGAAAACTGAAAT
GCCTGAGTGTGTCTATTTGATTGGTCTATTCATCATTAGGTTGCTAGAGATGAAGATCTAGTTGAACAAATTGGAAAAGATATATTTTTTGATCTTGTTGATCATGACAAAGTACGGAGC
TTTCGCATCCAGAAGCAAATGCCATTTAACCTTTTCAAGGTACTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTGTGCTATCTTCAGCAATATCGGGTATAAATCATC
TATTTTACTTGATGAAAATATTATTATATGGTATGTGCAGGAGGAGGTGGCTAAGGAATTTGGTATACCCATCCAGTTTCAGCGATATTGGTTGTGGGCAAAGCGTCAGAACCACACTTA
CCGACCCAACCGACCATTGACACCTATGGAAGAAGCACAATCCGTATGTATCTATCTCTCATCTTGTAAAGGTGGAAATACATCTGTTCTGAAGGCAGGGACAGAGCTTGAACTTGAAAA
TTGCAATTTAAACTTATCATTTAAAGGCGCGAGTACAATTTTTGTTCAGAGACGGGGACAGCTAGAAATTTCTAGGAAGGGGTCGATAAAAATGTTACTATATCATTATATAGAATGCTT
GAAAATGTCATCGATTAACTTGTAAATTGTATTATGCTTTGCGAGGACACTTCCTTTTCTTCAATTGTACACCTTGTGTTTCATTATTGCTTCTCTCAATTTAATTCAAAAAAGAAAAAT
TATTGCTTCTCCCATTATTGGTACTATGGTGCTAATGGAGCCGCTTTCATGTTCTCTCATGTTTTTTCTAATTTTCTGAAGATGGCCATTCCTATAGGTTGGACAATTAAGAGAGGTATC
AAATAAGGTTCACAACGCTGAGTTGAAGTTATTACTGGAGGTGGAATATGGACCGGTAACTGTATTTTTCACTCATTTCTTAATTTTGTGACTACTTTCTTATCCCTCTTATTTGTATAA
TTTTTTTACAATTTCATTCAGGATTCCCGGCCTATTGCTCCACCAGACAAGACAAAAGATGATATCCTATTGTTTTTTAAGCTTTATGAGCCTGAGAAAGAAGAGCTGAGGTATTTGATA
GAATGTTTGATATTCCCCTTTCAACTCTACTCTTGTGGAATTGGTGATGTGTTGACATGGTGTTTCACTCTTAATCTTTCTACAATTTTAGATACGTTGGAAGGCTCTTTGTGAAGGGTA
ATGGGAAGCCTTTTGAAATATTGACGAAATTGAATGAAATGGCTGGTTATGCTCCTGAAGAAGAGATTGAACTTTATGAGGTCTGGGCTTCATCCTTCCAATTAATTGTTGATATACTAT
AAATTTCTGTCTCCTATTAATTGGAAATTATTATCTTGAAAAGATGATGTAGCTAAGGAAAGGGGTGAGTTTGAAAGGTTTATCTGTATGCACAAATCCAGTAACAAACAATGCAACAAG
CTAGAACTGCAAGTTGTCATCTATTTTTCTCATACAAATTTTCATCTGCAAATTGTTTAATGAAGAAAATTATGGGAAACTATGAGTTTTTATTAATCTGCAAGTTGTGGTAAATTTCTC
ATACTGATGTTGATGTAAAGAAAAAGGAAGAATAGCAAGGAAGGTTTTGCTATCTTCTTTATTGACATATATGATCTTTAGTCCTGATAAGTACTTTAACTTAAAGAATCAGGTTTTGAT
GTTCTTATGGTCAGTATGATTAAATGCCTTTGTAGCACTGTTAGTTGGTTGAATTAGTAACCATATCTCTCCTCTTCTTAAACATCTATGTTGGTTGCAAGAAAGATTTCCTTTGACATT
TGAATTCCTTGGTCTTGATATTTTTGTAACAAAGATTCACGCTTGCAATTATATGAGTCTATGACCATTGGTTTTCTGTGGCCTTGTTAATGATACTTGTAGATATTCCTAAGACTTGCT
TTATTGCAGGAAATTAAGTTTGAGCCGAACATTATGTGTGAACCTATTGACAAGAAATTCACATTTCGAGCAAGTCAGGTAATGCTGTTTTTACAAGTGCATCTTTGTGCTGATTTTTTG
AAGTATTTACAGTAGTTAATCTAAAAGTTATTGTTTCTGATGCAGCTGGAAGATGGAGATATTGTTTGCTTTCAAAAGTCCCCTCCAGTTGAAAATACAGAACAGTATCGTTACCCTGAT
GTCCCCTCATTTTTGGAGTATGTGCATAACCGTCAAGTAAGACATCAACGTGTTTGGTGGAACTGCTGTAGGGTCATATGATCGAATGCTCACTCTTAAACTTTTTGGAATTATTAATAT
ATTGATAGTTTATTTTTGTAAAAAAGAATCTCATTAACTTTTTGGAAAAGGAACTATCAGACCTAACTTTTTGAAAAAAGAATGTGAGTTGGAAAAATCCATTGAGATCCTTCAAGCATT
CTTATGATAAATTAGAATAATCCATAAAACTGAAGTAAGTTGCTCCTTACATCTTTGAGAAAATTCAATTGAAAAGGATTTTGAGTTATTCATGCCATAACTTTCTAGTGTTCTGGCTTT
TGAGATTTAGGTGTGCATGTCTAGAATTTTATGTCCCAGCGCAAGAGGATTTGATTTGAGTTACTATTTAGTTACTTGCTCTGTTTTTGCATGGGAAAGCTGTTGTGAGACTGCTAGATT
AAAATCTTCTTCATGATATAATTTTTCCGATCTCTTATTGGGTTCTTCACCAGATATATGTTTAAACTGGGATTTTGTAATTTTTTATTTTACTTTCTTTCACTTCCTTGAAAAGTAATT
TTTTTTTGTTTCTTAAAAAAAAAAAAACACTTCAAGGCTCCTTACCTCTATGCTTTTGTCCTGTAATGAATGCCAAAGGTTTATAGTTTAGACAGTGGTTTGTGCATGATTGATTGTCTA
GGCACTGATTGGTTATGATAATTGATTTGTGCTATTAGGTTGTTCATTTCCGATCCCTAGAGAAGCCAAAGGAAGATGATTTTTGTCTGGAAATGTAAGTGGTACAGATTATTTATTATT
GTGATAGCAATTATAAAGTGCTCACCACTTGAATTACTTTATACAAAATGTCTATGACTTCGACTTGCTGTAATCGTAAATTTTTTGGCTGTATGTTGCGTTGTCTTGTTTTCTTAGGTC
AAAACTTTATACATATGATGAAGTGGTGGAAAGACTAGCCCAACAGCTTGGTGTAGATGATCCATCAAAAATTAGATTAACGTCACATAATTGTTACTCTCAGCAACCTAAACCGCAGCC
AATCAAATATCGTGGTGTGGAACACTTGTCCGATATGCTGGTTCATTATAATCAGGTTATTATTCCCACTCCCTGAGAAATAAGCACAATTAATATTTCATAAAATCTAATGGTTTTTAC
CTAATTGCATGTACAGACGTCAGATATATTATACTATGAAGTATTGGACATCCCTCTTCCAGAGTTACAAGGTCTGAAAACTCTTAAAGTAGCATTTCATCATGCAACTAAGGATGAAGT
GAGTATATACTATATAGTGATTGAATTCCAAGTTTAGGATATGTTACAATATAAGTATTTGTAAATGTATTTCTTACGTGCTTATTTGCATACATTTGAGTGCATTGTGTAACAACTTTT
TTCCTAACAATTATATCCCATGCTATCAGGTGGTTATTCATACAATTAGATTGCCAAAACAGAGCACCGTAGCGGATGTGATCAATGATCTTAAAACAAAGGTATTTCTCAACTTCTTTT
GATCCAAATCTATTGTGGGTTGGTAGACACGTGTCATCAGTGCAGCCCATCTTTTATTAGGGTAGAGGCTTTTTCAATATCCCTTTCTTTCGTGCTTTTTTGTCAGTATTTATTCTTTGT
ACTTACATTTTTACCTTCATAAATAGGTTGAATTGTCTCATCCAGATGCAGAGCTCAGATTGCTTGAAGTTTTCTACCATAAGATCTACAAGGTGTGACCGTGTGAGGTCTTTGCATGGC
TATTACTTTATATCGTTGACATTATTTTTAGTTTTGATTCTATGCAAATGGCATTTTCTTTGAAAAAATAATAGTTGTATATAACTACTCTTTTTCCTTTATTGGACACTGAAGACGAAC
AACCTTTCTTCATAGTTTAATTCTGTCATCTGACACAGGTGTTTCCTCCTAATGAAAAGATTGAGAACATTAATGATCAATATTGGACTTTGCGGGCAGAAGAGGTGCATCTCTTATGCA
AGGAAATTTCTTAGATTTTTTAGAATGTGAACTCTCTTAGCTTTGTTTATAGCCTCATTTTGTCCTCTTGTTCTTTTTACAGATTCCAGAAGAAGAGAAAAACCTTGGTCCAAACGATCG
CCTAATTCATGTGTACCATTTCACTAAAGACACCGCTCAGAATCAGATGGTAAGTATGATGCAACCTTGTCCAAATAATAGTGTCATTTGTTGATATTTGGATATTCGGTATTTAGAATA
AATAGGATTATTGCTGGACATGATAACCTCTTTAATGACTATGGAGTTTCCTTTGTTATCTATAGCAAATTCAGAACTTCGGCGAGCCCTTTTTCCTAGTCATAAACGAGGGAGAGACTC
TGGCCGATATTAAATTGAGAATACAGAAGAAGTTACAGGTTCCAGATGAGGAATTTGCCAAGGTACCTTCTTAATTTTTTCTTTGCACCATCTTGGACAAGCCTTATTTTGCTAAGATGG
GTAGTGTTCACAATTACAAGTTAGAAAACATTGGTATTACTATTATTAAGCTGGAGCACTCCTGATTAAATTAACTGCATTTTCTGCTGTCTATGTTTTTTCAGTGGAAATTTGCATTTC
TTTCACTAGGTCGTCCAGAGTACCTCCAAGACACAGACATTGTGTCAAATCGTTTTCAGGTTCGTTTTGAAGTTTTATTTTTATCCAACGTGTTCTTAGGTTTGAGTAGATAGCATTCTC
AATATAATTGTGTGTATCTGGTTTAGAGAAGAGATGTTTATGGTGCGTGGGAGCAATATCTTGGACTGGAGCACACTGACAATGCACCCAAACGAGCTTATACAGCAAATCAGGTGAAAT
GTCCATATCTTTTGCAAAACATTTTCTAACATTTATTATGGATTAAACTGAATGAAACATTAATACGAACATTTTGGTGATCATTGCTTTGCTGTTTTGTATTTTTTTGAAAAATTGATG
CAGAATCGTCATACGTTTGAGAAGCCAGTAAAAATCTACAATTAGTGAAAAGAAAGAAGATAAAGACAAAGAGAAGACATGGCTGGGGTTGGTTGTGTCTTTGATAGAGGCAATTTAGTA
GATGAGTTGGAAAAGCTACCACACATATGGGGTTGTTAGATTGGTGAGCACTGGAGCAGGATTCCATTTAGATTCTGTTGGCCATTTATTCTCTAGCAATGCGATGGATATGGGATATTC
TATGGATTATGGATAACGGATGATGATGGGGGAAGGATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGGATGTGTTTGTTTTTTAGTGTCAAAAAAAATCAAAATCCCCCCC
CTGATCTTTGTTAATTACAACAGGTGGAGAGGGTTACTCTTCCCTCCCCTCTTCCCTACTACTTCTTCCTAATCCTCCCTCCCTCCTACCCGTTGACCATGCAGAGAGAAAAGAGGCCCT
CCCTCAGCATCAGTTGAGTTTGTAATCTATAGTTCATAAAACAAGATTTTTTTTGACTAAGTAGTTGAATGTACACAAAGTATAGTTGGGGACCTCNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNCCCTTTTATTTTCCCGTTTTTTTTTTTTTGGTTTAGTCAGGAATTGGGGGGCAGTCATGGTTGTAAACTTCATCTTTTGTCCACGGCTGTGTATTGCATTTCTTGTCAT
CCAGGACAACAGGCACTTCTTCATTTTGTCTTCCGTTTCTTTTCTTTTCTTTTGAGAAGTAAACATTTTTACTTGGCTACTTCTTCTATACATATTATTACATAACTCCTTTCTTATTTT
GTCCTTTTTTTATCTTCCCATTATTGTTTTTAGTTTTCATATTCCATTTTTGTATTGGATGTTTAACTAACGTGAATTTTTTCTAAAAAATTAAATTATGAATGTACGTTTAGAGAACAA
AAAAATGAGAAAGAGNNNNNNNNNNNNNNNNNNNNNCGTCTTGATCTTTATTCTTCTTTCATTCACTTCACTTCCCTTCTCGTCTCACTGTTGTTTCTCTTTCACCCATTCGTCTTCGCT
GCATAGTTGGGTATGGATCATGCATAGTTGATAAATTGAATTGGACGCAGCCTCCCTATGTACCTCTCCAGTTCTACATTTAGAAAATTGAGGTATGCTTCTCCGACTGTCACAAAGGTC
ATTCCCTATAACTTCTACTTTCATCAAGGATGATATTTTATGAAGTGGAATCGGACTGCTGGACTGATTCAAGGGGAAATAACTTGCTTACAATCTGTGGATACTAAATAGATTTTACCA
AGTAAGCACCTTGCATTCAACAATCAGTTAGTCAATTAATGGTCTAACTGGGTCCTTTTGATTCAAATAGACGGGGACTTCAGCACCTAAAATTCAACCAAAGGAGAAGCTTGTACAAAT
ATGACGCGGCCTGTTTTTGGCTGTGGTGGTGGTGCTTTTGTGCATCAGCAAATTGGTATTTTTTTGAAGCAGACACCATTTATTTATATAATGTCTGCCTTGTCAGCGTTATGTGCATCT
TTTCGTATTCCTTCACATCTGTATTATCCTCACAATAAATAACCATTAGTTTTATTCAAACATCATATAACATTTAACAATTAAAAGTAAAACAAAACAAAAAACAATTGATGATATTCG
ATAGGACAGAAGTATTCACCAGAAAACGGCAGTCTCAGGCGGCTGCCGGCCACTCGCCCTTTTCTCTCCTTTAATTCTTCCCTTTTTCCACCTTCCTTTCTCATCTCTTCTTTGTTGAGC
TGAAGCCATGGCTGCTCCCATTGAAGTCGATGAGTGTCGTGGTGTTCTCCGCGTTTACAGCGATGGCTCGATAGTCCGTTCTTCCAATCCAAGCTTCAGTGTCCCTGTCCTCGACGACGG
TTCCGTTCTATGGAAAGACCTTCTCTTTGACCCCATCCACAACCTGCACCTCCGTCTCTACAAACCTGCCCACATTTCTTCTCCCAAGCTTCCCGTCTTTTTCTACATCCACGGTGGCGG
CTTCTGCATCGGCTCCCGCACCTGGCCCAATTGCCAAAATTACTGCTTCCGCCTTGCCTCCGAGCTTTCTGCTCTCGTCATCTCCCCTGACTACCGTCTCGCTCCCGAAAATCGCCTCCC
GGCTGCCATTGATGACGGTTTCGCGGCTCTTCGGTGGCTTCAAGCCCAAGCTGAATCAGACCACCCTGATCCCTGGCTGGCCGAAGTGGCCGATTTCAGCACAGTTTTCATCAGCGGTGA
CTCCGCCGGTGGAAACATCGCTCATCATCTTGCGGTGGGACTTGGCGTAGGTTCGCCTGAGTTGGCGCCAGTTCAAGTGAGAGGTTACGTTCTCCTGGGGCCATTCTTCGGCGGAACGGT
GAGGACTCGGTCCGAGGCTGAAGGCTCTAAAGAAGCATTTCTCAATCTGGAGCTCATCGACAGGTTGAAATCAGATAATGAAATTTGAATTTGAGGTTGAAGTTTTTGAGTTTCAATTAC
AGTGAAGTTAGTTTTTGGTTTTGACGATTGAGCAGGTTTTGGAGATTGTCGATCCCAATCGGAAGCAACACTGATCATCCTCTTGTGAATGTGTTCGGACCGACAAGCCTGAACTTGGAA
GCGGTGGAAATGGATCCGATAGTGGTGGTGGTGGCCGGCGCCGATTTGCTGAAAGATCGAGCGGTGGAATACGTAGAGGAGCTGAAAAAACAGGGGAAGAAGATAGACTTGGTGGAGTTT
GAAGAAAAACAACATGGATTCTTTACCATTGATCCAAATTCTGAAGCTTCTAATCAATTAATGCTTCTCATCAACCATTTTGTTGCCCAACACTCTCTCTGATTCCTCCTCCTCCATCCC
ATTCCCATCCCCCAATCAATCTGCTTAATAAAAGTGTTTCAATCGTAATTCATATATTCATAAACCATCGAACTATGTTGGAATTTCTTACCAACAATACAACTCCTCCAATTTTATAAA
GATACGTGTCTATAAAATGGTTAGTTAATTGTATAATCTATGTAAATCAGTTACTACATAATTAAATAGTAATAAACTTTTGGACTCTCATTCCGTTATCAAAACACAAAGAGTATTTAG
AGTCTTCGATCGACGAGAGAGAAAGGATATTTCAAAATGTGAAAAAAATGAAAATGAAGGAAATGGTACACACAATAAATAGAACCCCATATGATTTAGAGAAGTATGAGTATGAAAAGA
ATAGTATACTAATAATAATGTTATTGAGTCATTAAGAACTTCAAAAAAGAAAAGATTTGTATTGATGAAAATAATAAATGAAAACTCATAATATTTAGAAAGAGATGGGATGGATGCGTA
ANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAAGTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGA
CGTAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAAGAAGTTAAAAGGGCGGGTCAATTGGGGCCGGGAATTGACACAAATTGGTGTTCCTCGTTGATTTTGGTTTCTTC
ATCATCCGTATCTATGCAAACTCCTTTCATATATTCCAACAGATCAACGGCGATATACGACAATTCTACCATTCCTTTTTGCTCTTAATCTTACGTCCCTAGTTTAATTCCCTCTTCATT
CCGATTCCGATTCCATTTCTCAGTTTCCGGTGGTGGTGCCCTCCAATTCGGACCTTAGGGCTTCTCTTTCTTGTATTGTCTTGTCTTTATATGGTTTTTGGAAAATTCTCTCCTCTTCAA
ATCCCTAGATCCTCCTTTTTCTACCTTTCTTTATCATTACCTCCCACTCTCCGTTTCTCCCTGAAGAACGAGTGATTATTGACAGAGGAAGATTTTGAATCCAACGGGAATGATGGATCC
GGAGCTCATGAGGCTGGCTCAGGAACAGATGAGTCGCATGTCCCCAGCGGACTTCGCCAAAATCCAACAACAGGTATGGAGTTTTGTTTTTTGTTTACAATTTTAGATTTCGATGTAGAT
CTTGGGGACATTAATTGCACTTTTTTTTCTTTTAATTTAAAAGAATGGAAATCATTGCCCCATAGTTTTGTTTTCAGTCGGTGGCAGATCTTAACTCGTGATTTTGTTTTAACGATCTCC
GTGATATTGAGAAGTTTTCGAATTTTATAATTTGTGGATATTAAGATCACTTAGCTTTACCCCGTTCTATTGTCTGCCTGCGTTTATTCTATTACGAAAGAGCACCGATGTTTATTTCCC
TTTGGATCGTCTCAAAAGAAAAGTATCCAGAAAACTTCAAGTTGCTATGTAAACATCGTGGAATTGGTTGTAATTTAAGGATTGAACATACCATTTGCGTGCTCGGCCAGTATGCTGTTA
ATTGCTTATAATTTATTTAATATCTCGTGTATTCGACCTGTCACTGTATAACTGAAATTGCTGAGTTATATAAATTTTCAGATGATGGCTAATCCAGAATTGATGAAGATGGCCTCAGAA
AGCATGAAGAACATGCGTCCTGATGACTTCAAATACGCTGCGGAGCAGTTGAAGCACACACGTCCAGAGGATATGGCTAAAATTGGCGAGAAGATGGCCAATGCATCACCTGAAGAGATT
GCAACTATGCGTACCCGTGTTGATGCACAGGCCAACTATGAATTAAATGCAGCTGAAATGCTGAAGGCACAGGTAATACTTATAGGGTTTGATTCAAACACTGCTCTATGGAGGCAGGGG
ATGTTTTTTTTTCAACAATGTATTTGATTCTATTGAGAATATTCTGATTGGTAATTCATCAAGTAGGGGAACAAGCTTCACAGTCAGGGGAAGTTCAATGATGCCTCGGAAAAATATTTG
CTCGTGAGTATATCATATATTTTATTTTCTCTCTCTTGCTCTCTCATCACTATCTTTCTTTGAGCATATTCATGACTTCTCTGTCTTTACTTCGAGATTCTTAGGCTAAGAATAACCTCA
AGGGGATTTCATCTTCCAAAGGACGAACACTTCTGTTAGCTTGTTCACTCAATTTGATGTCATGTTACTTGAAAACAAAACAGTATCATGACTGCATAAGGGAGGGTTCCGAGGTAAGCA
GATTTTTTTCTTTCTAATTCTTAAATTTCAGTTTACCATATCGATGTGATATTATGTGCTCTTAGCTTTTCTTTTTGTATGCTATCAACATGGTGTAATATCTTGTATCCTTATTAGTTA
TTACAAACATAATCAGCTTTGATGTAAAAAGTTCCTAGACAAGCTATGTGATCAATAACTTGTATTCCAGTGTGTCACCACATAAAATGCACAATCTTGATTCCAACTGAACTGTTTGAA
CTTTTGTATAAGCTTGGATTGTGAAGTTCGATGTAGTGGAAAATTTCCAAGCATGGGAGGAGAAAAGTGAAATTGTTCATTACTTGGTTGAAGGAAATCCCTTGTTTTTAATTAAAACAC
TCATATTCATGTTTAGATTTGAAAGGCAGCAAGCCCTTTGATTGGGGAGAGATGGAGTCCTTGCTTTAAACATCTTTTACATGACATCTTTACTAAAAGGAAAGTATACCGGTTGCTGAG
TGATGCACTCTGCTGCTAGCCATGTGCTTTTAGGAATTCAATTGTTTCATGGATTATTAATTGACAACAACCTCCTATGTATGAGGTGCCAGAATCCTTGTTATTCCGTGGGGAATTTTC
ACACCCTTAACTCTGACCAAGATTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAAGGTGGCATTTATTCAAATGATTGAATTTTTTATATTTATGATACCAAAGATTTC
ACTTACTGTAGGTTTTGGCATATGATTCGAGAAATGCAAAAGCACTTTACCGGAGAGGTCAAGCATATAAAGAGTTATGTCAATTTCAAGTGAGTTTGTGATGATTGATGGCTACCTAAC
TGATTTTACGATACTATACTCATTCAAATTCTACTATCTGCTGATATTTTTTCTGGATTTCATTTTGTTAGGATGCTGTTTCTGATTTGAGCAAGGCACATGAAGTTTCTCCTGATGATG
AAACTATTGCAGATGTTTTATCGTGAGTTATTTTTCCCCAAATATTTTATACTACCAGTCTTTGAAACTCTTGCCAGTCTTTGTGTGGTTCAGATGGAGAAATGACTCACCTTCCCCAAT
TTATTTTATTTTTGGGCTAAGTAGGCGCTTACTCAGAGAGTTCTGTTTCGTAGGAAGTTCAACTGAGAATTTAACACCTGCTCTTGTATTTGTAATCTACTGTATCACATGTTTTCAAGT
GGCTTTCTTCATTCATCTGATATATTCTGCGAAAATAATTGTTGCCACAGGGATGCCAAGAAAAAATTGAACGAACAAGGTGGGGGGAATGTACCTAAAGGTATTTCCTTTTTGCTTTTC
TCCACTGCATTTTATGTACCTTGAGAGCGGTGGGAGGAAAAATTACGTAGAAATTGAACCTGACATTGCATTTCTAAACTATTCCATAGGAGTTGTCATTGAAGAAATAGTTGAAGAAGA
CAACCCTATATCCACAAACAGTTCTGTTTCAAAACCACCAGAAGTTATTGACAATTCTAAGATTGCTGATGCCTACAAGAAGAGTATAAACTCTGAGAGTTTGCAGGGACTGAGAGATGA
TCCAGAAGCTATCAGGTCTGCATGCTTTAATCAGAATTTTTTGACTTAATTATTTTATAGTAGGCGTTGAGCTAATCATTGAAGTTATTGTATTCTTTTGGGCTATTCATCGTTCTTCCT
CTTTTGTCTTCTTCAATAGGAATGTTCTTTTTTATATTAAAAAAATTGTAGTACTTTCTTCCTTACTAGGTCCACGAACATTTATGAGTATTTTGTCTAGTTAAGTTCTATATCACTTTC
TTCTATCCTTACAAATGATTTTGTGCGTGAGGATTTATTATATTTATTTATTCTGGAAATGAAACAAGATTTTCAGTTGGAGTCTTATCAACTATTGACCAGTGTTTTTATTCTTTTACA
TTTTTTATAGATCATTTCAGAGATTTGTTTCAAATGCTGATCCCGATACGCTAGCTGCTATGAACTTTGGAAAATCTGGAGGTATATCTCCAGACATGGTTGCCACTGCCTCAAATATGA
TTAGCAAAATGTCTCCAAGTGAGCTTCAAGACATGCTTAAATTGGCTTCTTCTTTTCAAGAGGCAAATCCCCTCAAGGGAGACAGTTTAGGCCCAAATTTGGACAGTGCAAACATGACTC
CGGAGATGCTCAGTTCGGCCAGTCGTATAATGAGTAGTATGCCACCTGAAGACCTACAAAGGATGTTCGAAACTGCATCATCTTTGAAAAGGAACGAGTCTGCTTCTGGGAATGGCAATG
TACCACCAGATTCTGATACGGGATCAAAATCTTTTGAGAGTCAACAATCCAGTATCAGTGGAAGTAGAACCACACGCAACACTAGTTCTTCTGATGCGTTGTCAAACTTACGAAGTAGTT
CATCTAACTCAACTATTCCAACCTCTTCTACTGATATGCAAGAACAAATGAGAAGTCAAATGAAAAATCCAGCCATGCAGCAGGTTTGTAAATCTTAAGCTATAAACGATATAAAATGAG
TGAGTTCATTTGCTTTTACCATACTTAACTCACTCTTAATAATTGGTTTTGTTTAATTTAATCTGTTAGATGTTCACATCAATGATAAAGAACATGAGTCCAGAGATGATGGCAAATATG
AGCGAACAATTTGGTCTGAAGCTTTCTCCTGAGGATGCAGCAAAAGCTCAGGAAGCCATATCATCTTTCTCACCGGAGGATTTAGATAAAATGGTACGTCGTTCGCTTCCCTTCCCGTTA
TCCCCCAAACAGAATTCTTCTTCTCTATGGTTCTGATAAAAGAAAGAAAAAATCTCTCTTAATTACAGATGCGTTGGGCAGATAAAATTCAAAGAGGTGTAGAAGGCGGAAAGAAAGCAA
AGAATTGGTTACTTGGACGTCCCGGTATGATCTTAGCAATATGCATGCTGATATTAGCAGTAATTCTTCATTGGTTTGGAATAATAGGTGGTTGAGTAAGAGATTCGCCTTTTTACTACT
CCTTATTTAAATTTTTGTATAACAAACACACTACTGACTCCCTCAACCTCAGGATTATGAAAAATTAACCATTTTGTTCCTCCTCCTCCCTTCTTCTCTCATATTGGTAAACAAACCTCC
ACTCTACTGTGTGATTAGTTATAGGATTTATGAATTCATTTCTTACTCATCATCAATTTTATACATACATGTCTAGAAGAATAACTCATTCCTTTTTCTTTTCTATCTTTTGTTACTTCT
ATATATATACATACATATATATAAAGAAATATTATAAAAGGCAATAGTAGGCGGTGGGACTTGGGGGATTCATGAACACCAAAATGGACTCTATATAGTTTTTGTTTTTCCCACGTATAA
GATTGTGGACAAACATAAACAAATAATGGGCGGGTGGACTGTGGACACGAAATTGCTCAACATTATCGATATGAATAAAAGGAAATGGTCTTGGTCTTGGTTACGACTTAGAAGNNNNNN
NNNNNNNNNNNNNNNNNNNNNGTGGTAGGGCAGCATTGAATTGAATTCAATTATCTGGAAACCAAAATCCACTTTGTCATTTTTCCCATTACTGCCAATGACCTCCATTTTTGTCCTTTT
CATTCTTATATTGGAACGATAACGACGCCTCTCCTTACATGAATCGCATATGTATCCCCACATTTAAGATTTTTCTTCTTCTTCTTCTTTTCTGGGTTTTTATTATCCTTCCTATCAATT
TTTTTAAAATCTTCTCAATTGTTTGTAATAAAATAAAAATGATGTGATTTAATTGAAACATAATACTATATATTAGGGTTTAGGGTTTGCTATTTAATATGCAAATAGGCCAGACATGGA
AACTTTTAAGAGATAATATTTTGTGCGATTTTGTGCTTATAAAATATTCAAATTTAAACCTCTTATGAGTTATGTGGTTATAGAATATTGAAATTTAAACCTCTTATGATTTGAAATCAA
TATTCACGTAAGTCTAGTACAAAAAAAAAACCTCACTATGTCCAATAATAAACTAATTATGAAACTATAATTTTCTTACTTTTAAGAACTAACCATCCTCCTATGNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATATGTTTCTATTAGTAACGTAAACATGGTTGATAGATATTGATATGTTATGTTTTTATTA
GTGATATTAATTGATAGAAGTCNNNNNNNNNNNNNNNNNNNNNNNGATATTGATATGTTCTATTAGTGATATTAATTGATAGAAGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTACAGAAGAAATAAAAGAAAATGAAAGTAAAAAAATTAAGAAGAGAGAGAGAGTGTGTGTTGAAGGGGTTCGTGT
TAGTGTTAGCGAGAAAGTGTTGAATGAGTGGTGGAGGACACGTCTGACCTTTTGAATTCACTATTTCATACTTCCATATAAATTCATATACTCTCCAAGAAAATAAGCAAAAAATCTTCA
CACAAAAGTTTTGCAAATCCTTTTCCATTTTTGTATCTTTCCTTCCCATTAATCGCATCCTCTTCCTCACTTTCCCCCTTCACTTCATCTTCTCACCATAACCCTCCTTCAAGAACAACA
CCACAATAATCAATCCCTCTTCGATCTCTTCTTTCTGGATTCCCATTCCCCTGTTTGCTTAATGCACAGTAATCCAACGCGCTTAACTTGACCTATCCCCGATCCAATCATGAATCAGGG
CGTCCTCCTCCGATCGCCCCCAGGTACTCGCCAACAACCCCTACTCAGAGACAAATCAGGCAACAGAGTTAAAGAAAAGCGCCGGTTCGCGGAGGTTGCCGGTGGAACAGCAGCGGAGTG
CGCGGCAATATGTTGTTGCTTTCCATGCAGTATGATGAATCTTCTGATATTGACGGTGTATAAAGTTCCAGTAGGACTCTGCAAGAAAGTGTGGAATAAGAGGGGAAAACGACGGGAGAT
CGCAAAGAAAAACGCGGGGGCGGGAGGTAAGGAGTGGGCCGGGAATGATGATGGTGGTGGTGAAAAAGAGGATTGGGGAGAATCGCTTCCGTCCTCGTATTTGTCATCGGAGGATATTGA
ATTGGAGAAGGAGATGTGGGAACGATTTTACGGAACTGGCTTCTGGAGGACTCCATCGCAAAGAGAAACTTAATCCTACAAAATTTTACTTTTTTTACCTTCATCAATACGTCAACCAAT
TATTTTAGGGTTCTATGATATGAACTTCCTCATATTCAAAGATTTCATTGTTTTCTTTTTTAAAACCAAATTTCCTCTTCCTCTTCCTCTTGAGACACATTGAAACATAAGAAGACAATA
TAAGATTTTGAATGTAAAGACTGAAGTCATATTCTTTTTAATAATAGCTCATCATCAATTCTTTTAGAATGTATGTTTGATTGGTAAGTGATACACAATATCTTCTCTCCTTTCTCTTTT
CTGCTTTTATTTAATATTCAACACTGACTTCCTCTCTTTTATTATATTCAAACCATCAAATATATAAGCACATTCTGTACTACTCTTAATTATTCTTAGTGTATATAATAGCTCTTCCTA
TAGTTGGATAGAAATAGATTTTGTTGGAATATTGGTGTATACAGTATACTTGAATACTATCCATTACAATCACTTTTTCTTGGCTTTTTGGCCAGTCTTTTACAAACGAGCAGGAGATTC
TGTGCCAACTCTTTTGTTTCTTGTTTTTTTCCCTTTTGTTTTGAACTTGTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAATTTCATCGAATGCC
CTAGTCTAGGGAGCATAGATGTGTTCTATTTTTCAAAAATTCAAGCAAGCCCAAAATACCCACATGGATGCATATCTACAGCAAGAGCAATTAGAGCAACCATTCTCTTCTCTATCACTA
ATTTAAACTCAAAGTCAAAACACTTTAGAATATCATCATGCTTCTTGTTGTTATAACTAAAATCTTTTAACTCACGGATTTGTATATTCATCACCTACAGTTGTTACCATCAAACAAGCA
AAGAATCCAATAACAGTATAAGAACAAATCACGAAGCATCATCACAACACTCAAAACGACGGATCCTGATGATTTAGGACTGAGGGAAGAAGAAATTTGCATTGTAGTGTTTGGTTGTGT
TGTAATTTAATCTAATGCTGATAGTTGAAGCATCAGGGAGAGATGAATCAAAAGGATTCACACTCTTATCTCCTCAATCAGATTATTCATGGCAATGATTGCTCTCAATTGGAAAAGATG
GACGATGTAAAGAGGACATGAAAAAAGAAAATCTTATGCCAAATCAAGAGCGAAACAAAGATTAACAAAGAAGACTTGTATATTTGTCATTTGTCATAAACTCTTACTTGATACAAGTAA
CAAACTAACAGCTCCTAACTAAGCTATAAATGTAATGAGTTGTTAACTTTACATCTTTTTCTACAAAAATTCATGTTACAAGTCTGCTATCTACAACAATTATCTATCTNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACCTTACTCTACTGTATAGAAAATTAATTCTCAGTAGATGACCACTAATGATTGAACTAGGAAGAGTTAGATAA
GTGTTGTCCATCTAGAACACATATACAATCCCACTAAGCTAATCAACAAGAGATGAGAGGTGAATGAGGAACCAAGACTACTGCTAAACATGAAAACCCACAATAACAGTTTCACAGAGT
TCATCAAATTCAGTAAATTGGACCAGAGATATTGAATTGGGGGTAGTTCATCACTAACTGATTCATCAAAATGAAATCAGTTCACAACTCACAGAATGGCCATTGTTCAATAGCAAAATC
TAATGGAAAAAAAAAGCACTTTTATTTAGCTATTATCCTAGCCCCATTTTCTTTGACATTCAGGAGCAAATTGCTGGAATTGGTTCAATTTCTAGAGAAACTCAAACTGTCAGGATTAGA
TAGCCGACTTAGCATACGGAATAATAACATTAATTCACAGTAAGAAGATGTAGGTGACTGCAAAAAACGCTCAATTTAAATCGAGATACTGAAGAACAATAGGAGAAAAATAAAACCCTA
GAAATTTAGCTGTTGCATTACTCCAATTCGTTAAGGACTTTAATTCCCATGCTATTGGCAGTGCCGATAATGGACTTACAAATGGATTCTAGTGGCATGTACTGGCAATAAGGATCAGAC
TGCTTGACTTTAGCGATCTCATAAATGTGCTTGACTGAGAGCGTGGAGGCGACTACGTGGCCTGGGCGGCTGCTCCCAGATTCGATCCCAGCAGCTTTCTTCAAGTACCAAGTAACTGAC
GGTGATTTGACGGTGAACTCGAAGGTGTTGTCCTTGAAAGCTGTAATGGTTACGGCCATGGGTGTCTCGGGTTTGTACTTTTGAGTCCGGGCATTGAAATCCTTGCAGAAAGCCATCAGA
TTCAGCCGGTATTGACCAAGCGCTGGACCCACCGGTGGCGCAGGGCGAGCTCCACCAGCAGGGACGGTGAGCCTGATGGTGGCAGCGACGGGTCGTCTGGTCAGAATCTCTTTCAAGGTG
GCCATAGCTGTTCGCCGGAACCTCCTTTCCCTGTGAAATCGAATCAAGAAATGGGAAGAGGGTTTATATTATATATATATGACCGAACCGGTTCGGACGAAATAAACCCTTTCTCGAACC
AAATCGATCGGATTGTAATATATTATTCAAACGGTCCAGTTTTTCAAAATTGACGAATATACCCTTTTAAATAATTTTGAAAAATTCCTTTCGAACTATTATCCATATTTATAGGTTTAT
CATAACAGAAAAAAATATTTTAGTTAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTCGCGAGTGTCTGAAACCATTNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGAATTTCTATGGAGAGAACATTTGTTTTGTTGTGCGTTGTTCATCATTCCACATAATTCAGATGATATTATATTTAT
TTAGGAGTAGGTTGGTTATTTTCGAGTCTTCCCGTAAGTCAAAGAATTCTTCCCATTCCAGCAAATGAGCATAGATTTATTTTATCTTTTCTTGTTTTGTATTACGGTGGGAGGTTTTTG
TGCCCTTGGAAGGCTTTTGCTTCTTGAAGAATTTCATTTGGAGAGAAGTGTTTCCAATCATAGGGGTAAGTCCTCCTTTGTCACATAACCATATAGGGTTTTCCACGTCTTGTGAAATGA
GACAGTGCACTACTACTTGTTATGACATTTTAATCTCTCCATTTTAAGAAATATGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGAACCTGAGAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTGTATTATAAATTGATTGTTG
TTTTATTTTTTTCATATTTTCCAATTAAGTGTAGACTGAAAATTGGATTTGACGGGGAAGGTGAAGTTGGTGGCGGCAAGACTTTGGGGGAGAGAGAGAGAGAGCGAGCGATGGCGATGA
AACCACTTGTGAACGCGTTTTCATTGTTGGAGCTCGACGCTGAAGACGATCAAATTCCCGCTCTTTCTACTTCCTCCAAAGATGACGCTACTGTTTCTTACCCTTCACCAACAGGTTCAC
TTCTAACCTGATTTAACCNNNNNNNNNNNNNNNNNNNNNNAACTCTCATGTTTTACAACTACAAGGTTGAAGATTATGAGAACTTCAGGAATCCGTTGATAGGGATTAGACCCAGATAGT
CTCTCCAGCTGTATTAGAATTTGAAACTATTCTTGTTTGTTTGTTTGTGCCTGCTTGCCTGGTTTTGATTTCTACGGCTTCCTGGATATTCACAAGGCAGAAACCCCATGAATCTAGGCT
GCCAAACTAATTGAAACAGTGTATTGGCATATAAGATAGTTTCTTTATGTACTATACTCTTAGTTTCTTCACTTAATATTTAGTTATTTTCTTACTTGGTTTTTCTCATTGTTGGTTTTG
TGATAAATTAATCCTTCACAGAGATGTATATTGTAATAATCCATCTTCTTTTATGGATAACACCATTGACGTTTCATGTACAGTGAGTAGGATACATTACTTAGTTGTTAGAATGGTTGA
TGGTCCTGAGAATTTCTTTTTCTATAGAAGATCCACTGCCTTTTAATCCTTGACACTGTTGTTTGACTAATGGATCAGGAAAAAGAAAGAAGGAAGTTAATATATCTGGTGATATTCTGA
CGGGAGAAAGACAGAAACAAGGTCAACCAAATGCAGTTGCAGAAGACTACAAGTTTCCTCTTGTTTGGATTGACTTGGAAATGACTGGTACTTAACAACTATTGCTAATCGCTAAGCTTT
ATACTTGTATAACATGGATTCAGGAGTGAGAGGGGATTATAAGAAACTCACTTTTCCTGTTTTCTTTGCTAGGTTGCAGCCTCCNNNNNNNNNNNNNNNNNNNNNNNGCCTTGTGTTCTT
CATTTTTTTTTTCAATATAAGGTCAGTTATTCATCATGTTTCTAAATTCTACACTGTGATAATGCCTAAGCCTATACTCGATGGCACTGTTTATCAGGGGAGGCTTTTGGAGTTTTATGA
TTACATTTATCTTCACCCAGGGTTGAACAGAGTTGATATTCAACTTATCGTTTATAAGTTTTTATTACTCTTTTTTTGTGCAAAATTTTTCTCCATACATTTCTTTTAGTTTTCCTTTGT
GCCAATGACATTGACTTCATTTTTTTTTCTTTTTGGTAATTTCATACTTCAATGAAGCTGTCTATCCCACCCCCTCCCCAAAAGAGAAAAAAAAAAATCAAAATCAAAATATAACCACTA
TAACTTGCAAGGTTGGTTTTTCTGTGTCTGCCACACTCAAGGCTTTGGGGCAAAAGAAATTGCAACCAACAAAAGTGATCATTTAGCAGCATCTATATTTTTGTTCAAGCTTATCTCTAC
TATCTAGTAGGTGAAGTTATGTTCGAGTTAAACTACATGCATGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATGCATTTTCTGACATCCCAAATAAATAAGGT
TTCTACTTTCTTAGTCAGGTGCAATCAAAATTCTAGTTAGACTTCTGTTAGATTCTGTTTACTATTTTATGCAACATCTTTGTCCAGAAAAGAAGGCCTATTGATTGTTGATCAATTATA
AGATCTTATTTTCAAAAGACACCAGGAGCAGACTATAAAACATTTGGGATGGGGAGTTGAGAGTTAATGCCTCTAATTAGGCTTTCCTTTCCAAATAATTTTAGAACTGTCAATTTGAGT
GTCTTAATGCGACTTTTGAGATCAGTTTTTGTCTTCTCCACAGTATCTTGAATTGTTGAACCCTTTTTTGGCTTATATGCAGGTTTAAATGTTGAAACAGATAGAATACTGGAGATAGCT
TGTATTATTACCAATGGCAACCTGACCAAATTGGTTGAGGTATCTTTGCCATTGGCTATTCAACAGTGTTTTCCATGCATGCATTCCCCACTGTTTGTTTATGAGATTTAATTTTGTACT
CTCTTTGACTTCACTACACTATTGCCAAATACTCGTCCCTGTTTATATTTGATCTGTCAATAATTTCCTTTTGTAAATAAAGTAAAGAAGAAAAATACAATATTTTTTTTTTAAGAGAGC
AAACTAAATAAAATATAGGTTTGAAAAGAATCCTGACCTCTGTATGTCCCTGACACAAGTGAGAGAAGTTCAAAAGTTGCAACTTACAACCTTGATCTCATCGCTTCTTTGTGGTTTGTT
ATGATTTTTATGCATTCTACTTATCTTTCTAGGGTCCTGATTTAGTGATTCACCAATCAAAAGAATGTCTAGATAAAATGGGAGAATGGTGTCAAAGTCATCATGCAGCCAGTGGTAAGG
ACCAACAGGCTTAATCAATAGAGCACTTCATCGTATTTTAATGGCTCCTGGCTTTCTGCCTCACTTTTTTTCTTGGGGATGAAACAAATTGTGATTTATGATTTAGGATTGACAAAAAAA
GTACTGCGAAGTACAATTAGTGAACGAGAAGCTGAAAAACAGGTATGTAAAAATTTATATGATGTTTTTCCTTCTCCCCTCTGAATTTTTTAATTTTTGTTACCAGGTTTTTTATTTATA
CTAATATATGTCGTTTGATCCTTTTTTAAAAAAATTGTGCATTCTTTCATTTTATCTTAAGAAAAGATTTATTTTGTTCTTTTGATTTTAAATTGTCATTTGACCTTTATATTATTATGA
TAAATTTTGGGTTTAAATCCTATTTGGTTCTTAAATTTTCAATTATGTTCTATTTTGATCTTGAAGTGTTTTGATCCCTTACTTTCAAGTAGGACCCATTTCCCACTTGCAACGAAGATT
CTATTAATGGACTAACGGATTTGTGGTGTGTCTATAACCAATGGAATGAGCACGTAACACTAATTTTGACGCCAAAACCGTACCTGAATAAAAACCTAATTGATCTGTATGTGTGACGGG
TCAGTTAAGCCATGTAGGAGCCTGATCATTTAAAAATATACTACAAGGCATAAATCTGTTGGCTGGCTCACTAGTAGAATCTTAGTAGGAAGAATCAAAATAGGCATTATTTAATAGCAT
CGAGAACAAAACAAGTGTGTTAGAAGTTTAGTGACTAAAATAGGATATGCACTTATGGTGCCATAAATGTGTGTGTAATCTGGTTGTCTGTCATTTTGGTCAAATTTAATGCCCTGACAT
TTGTAATTCTGCAGGTTATACAATTTGTGAAGAAACATGTTTGTACCGATAAACTACACTTGGCTGGAAATTCAGTTTATATGGATTTTATTTTTTTGAAGGTAGTCTCAAAGCAGTCTT
CTTTATTTTCTCATAATATCATGCACATACAGTGTGTTAGTAGGTAAATGTTTCAGTTTAGAAATTCTTTCTCCTGCGTTATCTGTTCTTCAGCAACTTTTTGCTGCTTTCATTTTCTTA
ATGAAGATCATGTCACCTTAAAAATGATATTTTGTATATTACTTAACATTCAATGATACCTCATTCAGTTTACGCATGCCTGATCTATTTGCATTATTGAAAGTTTCCCCTGAATTCGCC
AAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACCAAGAAAAAAAAAGGTTTCTCTTGAATTCTATTAGTTAGAA
TTTTGAGATTTTTCTTTGTAGGATTGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNTGGTGTTTCATTATTCATGTTCATATAATGTAACCAAAAATTTTCGTTGGGATATGCCATCATACCTTCTTCTCCCTTTTTCTTTTTCTATTCAATATCC
TCCTCTCGGGCAGTTACAAAAGGATGCGGGAAATGCATATCAACTAGGGGAATAAAATATAGCTAGACCTAGAACCTCTGCTGAATTTCTTTTTACATAAGCTCTTGTTTCTTTCTAAGT
ATATTCTTAAACTAAAGCTTTTTGTGCATTGCGTCATGAAGTTTTGGTCCTTTTTTAGTTTATACCCACAAACACTTGCTTAGTATTTTTTGTATCAGAACTCTCATCACGTAATAGACT
TCGATGAGGATAAGAGAAAGGCCCATGGTTGCACAGAGAGGCAATAAAAAAGAACCTTGAAATTCTGTTGCTTTCTAGCCGAGCAAATAGCAGCTGGGAATGGGATTTAGAACCAAGTTT
GACATCTAGAAATCTGTTTATGTTCACTCCCACCAAGCAAAGATGACACGATGATTGACAGGAATTTCTTCTCTTGGTGCAACTTATATTCTAAATAGCATCCCTGATAGACATCCTTCA
AGAAAAGGTTGGTCCCAAGAATTCTTAAAATGATGGTGCAATTGAAAAGATTCCAGATTTCAAAGCTTCCATCCCCTTTTACTCTGTTCCCTAATTTAACTGTATATTGCCCTGCAAACA
GAAGTGATTTGTCCCACCCACTTATCCCAAGTCTAGATTTCTTCCAGCCAAAATATTCTATGAATCAGCGATCTTCCATAGTGTCAGCCTTCTGAGTCTTTGTTGAAGTGTTAAACTCCA
CCTAAGTTTCATGCCTAGAGGATGTTCAACCAACTTCCAGTTAAACTGTAGTGAATTCTCAATTTCCCCTTAAATTTAAACAATAGTCCATCCAGGATTCTGCCTGCCTACTTGATTTCC
TTTCTCTGGTAAACTTACCACCTTTCCATTTCAAAACTACCAGTTGTAATTTAGTATCACGCTTGGTTTGCTAGATTGTTTCAGGAACTGCCAAAACCAGTTTATTAAAATACCTCATTC
CTTCTCCTTACGGTTATAATGCTAGTTTATCATTGCATATTGGTTGTGAGATGATACTCTCCTTCTTGACTACCACCCAAATCAAAGTCTTGGACTCTTGAGTTTTCATTTCACTATCTG
AGGCTGAACCACTTTTCCTTTCTATTATTTCTTTCTTCTTCTTTCATACGACCCTTCCCACGTTCACTCTTCTAACAAAACTTGGAAATTTTGCTGATTTAGCATGTAATATATTCTTTT
GACGTGGTAATCTTATTGCTTCTATAATTCACCAATTTCTTAGGTAGTTGCACGTACTCTTCTTTGTTCAAAGATCTCTTATTCATCTTCTATCATGCTTTCATAAATACTGCTTTGCAG
TGTTTTTTGTTCTAACGGCCTGTTTATTCCCTTCAGAAATACATGCCAGATTTGGCTGGACTTTTTTCGCATGTGCTCGTCGATGTCAGTAGTATAAAGACTCTTTGCGATCGCTGGTAT
CCAAGAGGTAAAGATCTTGACAACTGGAGTGTTTTCACTTTTGAGAAAAATGACGGCCATGTTATTTTGATTTTTCTGTTTCTTATTAAAAATAACAAAGGTAGACGTGTATTATTTTCT
TGCAACTATTGGTATGTTATTGGAAACCTGTACAACTATTCTTGTTCAAAGAGATTGAGAAGAAACCAAAGAGATTCTGATATTGAATAATGTGGAGTTCTTATACATTGCTTGTCCACA
GTCTCCTCTCCTTATCCCTTAATCCTGACAGAGGAATATGGAAACTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCTTTATTCACCACTACAACTNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTACCTAATAATAATAATACTTGTTGCCTCATGGGGGGATTGTGAGTTCATAGC
CAGCTCAATATCATCTCTGAAAGATATTGAGGAGACTTTTAAGTTTTATTAGCACTATTCTCCTGCATCAAACATTTACTTGATTCATAACAATAATAATGGTTCTTGGCCTCTAATGGA
AATCTCGCAGGTGCCTATGATATGTTTAGTCTTTTTGTTGACTATCAGTATGTACGATTTACTTTATAAACCAAACATAGACTCAGCTTAGAACATTTGGTTATTCGTTTACTTGTCCAT
ACATTAACAACCCATTTCCTTTCCAGATCGGAAGAAAGCCCCGCCAAAAGAGAATAAACACAGGGCTATGGATGATATCAGAGAAAGCATAATGGAACTCAAATATTACAAGGAAAATAT
ATTTAAGAATTCAAAAAAGTGATGCAAGAGGAAGCACCATAACCAGAAGATTGCATGCTTGAACGGTACGGAGATTTTACTTTAAATTTCACGTCTATCATTCATCTCCTAATTCAATTG
TGTATAATGTACTACTATCTTCTGTTATCGTGGATGTTCTGCTGTTAAGTGGTGGTTGGATAGACTTTTACATCTTACCACTTTGTAAAGTTTAACTCTTTAAGGTGCGTATAAATTTAA
TTGATGAAATATTTATTTATATCTTATCTGAAAGTTCTTTAGCTGAAATAGTTGCTGGATATATTGCTCGGAGCCTATGTAGTATGAGAAGATTTTATGCATATGATATCTTAACTGAAT
TTGCGAAATCCAGAAATATTATTTATGAACATGCGTGGTGTGTACCAATTTTGTTGAAATGAACTGATAAAGGGGTAGGATATGCTCGTTCAAAAACTATACATCTTGAAGCTTTTTCTT
GAGTACAAGGATCAAGGATGTTTATTTGCTATTTTCTTTATATTTAAGGTATTTTGTTTTGATAAACACTTAGTAATTCAAAGATGTGGCATTCTCTGTCAAATTAATGGTGAAGAAGGA
GAAGGCAGCCATGGGAGTGGAGCTCGAGACTGGGAGAAGAAAAGAGGGAAAAGGCTGGAAAAAATATAGAGGAAGCCTATTTTCGTCTTTCTTATTTCTTTCTTTTATGGTAAGCATTTT
AACTCAAGGTCCTACCACATCAAATCCTTCGATCTCTATCACGTGATTTTATAACCTATCAATCCTATCATTCTTGAATAATATACAAATTTTTATTTTTTTTCTAGTATTTCAATAACA
CTAACGTTGTCCATGTCTCCTTAACTTTTTTTTTTTTTTTGACAAAAACCAATTTCACATGGAGTCAAGAATTCTTACTTAAAAGATCTAGTTGGATCTTCAAGAAAAACGGTGACATAC
AATCTACCAACGATTTTTCGAAGCGAATAACAACCTAAATTCACGACAAAGAATTGAAGGTGTGTGNNNNNNNNNNNNNNNNNNNNNNNCCCTAAGATGAATACATAGTGATAAACAAAA
CATATAGCTTGAACTATCATGGAGATCATAATACTCTTTTATTCCTAATACTAATTAGCTAATTATTCCAATGCCATTCATATGAAATTCCTTAATATTTAAGAACTATGAAAACATGGA
CAAAGTGTAGAAAAGTAATGCTAGTGGATTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCCGTTTTAAATAACATAATAGAACATGNNNNNNNNNNNNNNNNNNNNNGGAGAA
TTTTTAAAAATAGTAGATTTTGCAAATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNATAAAATATACTATGAATTACTACCTTTAATTGTAATACCTATAACCTAAATCTATATCTATCTATAATCTTCTATACAACTATATTATACATAAAATCTTTTAGTAT
GTTGTTATGTTCTAAATGTTTCATGTAGATAACCGTCTTAAATTCGTTGCATGTATTTATATTTACTTTTATTGATACAATTAGATTTGTGTGACATTCAAATTTGGAATAAAATTTGTT
CAGAAGCAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCATAATG
ATGAAGTAAAAGNNNNNNNNNNNNNNNNNNNNNGGACATTTTAATTTTAGATTCTATCACTTAAATTCTTAACAAAACAATTTGGTATAAGTCGGAAATATTGTGTAAAATCTACTCATA
TTAAAAATTCCTGAAGAAAACTATTTGCGCTAAAATTTGGATGATTATAATATATAAACGGGATGTTTATGAAATGTTAAAGAAGCGAGAGATTTGAGTTAGCAACTCCTCAATCTTCTC
ATCGCCTTTTCTCTTCACAACCTCACTCATCTCTCTTACTTTCATCCTTAATTCTTCTCTGCTTTTCTCAATCACTACTTCTTTGATCAGTCTTGCAATTTCTTTTCTTTGAATTTTTCC
GTCAGGATCTCGTTTAGCCTCTACTCCGATCCCTGCTTCTTCCACTACTCCGGCGTTAATCGGTTGATCTCCGAACACCGGAACTCCAATTATGGGAACCCCAGACACAATACTTTCCAA
AACAGAGTTCCATCCACAATGGCTTACAAATCCCCCAATGCTTCCATGCTTCTGTATCTTCCCCTGCGGAGCCCATCCTTCCACTACCATTGCTCTTTCTCCACTCTTCTCCAGCAATTC
CCTTCTCCTGATTTGTTGTTCTTCATCTCCTTTTTTATTAATCCGTTCAACCCATATGAAATTCGCCTCACTTTCTACTAACCCTTGTACTATTTCTTCCTTTTCTTCCTCCGATGCGTA
GCTTTCGCTTCCCATTGACGCTAGAACCGTTGACAGAGCTTCCTTTTTGTCCAGCCAATTCTTAATTCTTGAATAATCTTCATCTTCTTCATCATTCTCACTTGGTTCGTACACCAATGG
CCCAACTGGGATTACTTTCTTTTTTGATAAAAGGAAGATATAATCCATGTGTTCTCCCTCCACCTCTTTGAAGCTATTAATAAGAATTACATCGCGAGATTTATTAAGGCATTCGAAAAA
AGATTCTGTGACTATACGGATCTGTTCTGAAGGGTTAGAGTCGACCTTGGATTTCCAATGATTGTGAAGTACAAAATCTGAGAATGGGAATTTAGAACCGGGGCGATGAGTTGCGTGAAA
GCTAAAGGAAATGATGGCAGCGCTGGAGGTGTTGAAATGGATGGCGGGTATGTTAAGGGAGGAAGCTAAGCGAGGAGCCCAAGGCTGGAAACAGTCATAAATGAGGAGATGTGGAGAAAG
TGTTTTTAAAATTGTCTCAAAGAGAGGGGCGGCGGCAGCGAAGGCTTGGTAAAGGACGGGCGTAAGGTGAGGAGGGAGGGCGTTGGTTGTGTGAAGATGGGGAGGAAGGTCAGGAGAAGA
AGGGAGATGAAGCTCCACAAGTTGAATGGAAGGAGAAGGAATTAGCTTTGGTTTAATGGAGTCGAGATTAACAGGAGTTGAGCAGAAATAGATGAGGAAGTTTTTCCTTGTAGAGAGAGC
TTTGGCGAGCTCCAAGTAAGGAGAGAGATGGCCATAGCCAAGCCATGGAAACATCAAAATGGTAGTGGTGGTTGGAGTTGAAGCTTGGTGGGTATCCATGGCCATGCAAACAATGGGCTG
AGAGACTGGGTTAACAAAGCTTTGTATTATTTATAGAGGGAGTAGGGAATGGGGAACGGGGACTGGGGACTGGGGAGGAGTATCGTATCTGTTACCACGTGTAGCACGTGGTATGGGTAG
ATTACAAACCCATGCAAATTGCAAATTGCAAAATTGCAAAATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGAATAAAGGAACAAATATGGATAAATGCAAA
ATTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAAACTTTTTATTGATTTAAATTTTATTCTATTGCTCTTTTTATATG
TATATAAAATTACAGACAATTTTGAGTTATAAATGTTGAAATATTTAACATACTTTATTATTGTTATTTAGAGAGAAAAAAAAAAGAAACATTTAAGAATTTTCAAACATTTCGATATTT
TATGGGATTGTCGTTGGGGTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAGATATGATTTAGGAACCGATCTCCTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAAACATGAATGATAGTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
ATTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTAAAATTTACCTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGAGATGAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAATGAGATTTGNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGAGCGTGTGTAGTCGGTGTTGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTTAGCCGAGGAGAGAGAGAAAAACAACATTATTTTCCTAAATATTTTTCA
AACTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATTGAAGATTTGGTTTTCAAAGNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCAATGAAGATAAGTTTCTAAAGAATCATTTTAAATCATTATCATTCTCTTATATTATATGAATATTTAAATATGGGTGTATATGA
TAAGTTTAAAAAACAACAATTAAACTAATTATATACTATGATTTAGAGACCAATCCATCATCTACATACATGTATGGACACGAGCACGGTTGTGGATAGNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGAATGACATTAATATAAAAACCAAAAAATTACTAACATAAAATCGCACACTCAAATAATGAAATTTTGATT
AATGGTTGATCGTTACAAATCTATCCTGCGACGTAACCAACGTAAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATTTTTTTTCTTATCCTCACCATAAGTTACATATTATTTTTACTTAAAATTGTTTTAAAATGAAAACGAAAATAACNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAATAAAGTTAGAAAATATAGAG
CGATATGATAGTAATTGACATTGTAGTAGAGATGAATATAGTAAAAGTGAAGTAAATGGATTGTGACTCGTTTTTGTAATTTACAAGTTATACAAATTAGAAAGAGACTCTCAAACCACT
CTGTAGAGAGATTCTTCACGATTTCATAGAATGTGGTTAAGTCTGGAAGGGATTGAGACTTGAAGAAGTAATTAATCCTAATTAATTATACCTTAATAACTTCATTGTTGACTTTATTAA
AAATTGCATGTGTAATAAGGGTTCTAGTGATAAAGTAATGGAACTAGCTCGTTTATAATATGTTAGCGACCATCAAAATGTTTATGATTTGATTTTTTTGAAACCGACCCTTAGATCATA
TGATATTTTGGGACCGACCCTTAGATCACAACTCTCTTTTATTTCTAATACTAATTGGCTGATTATGTTAAATCTCATTCACATGAAAATTCAAATTCTTTAATATTTAAAAAACAACTA
TGAAAATATGGACAAAGTAGTAGAAAATTAGTGATGAGTCAGCTAGTGGATTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAATTTAGTTACTCTTCAATTATATATG
TGTGTAATTTAAATAACCTACAATGTTAGAATATGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACTGAATTACTACATTTAATTATAGTATCTATAACCTAAATCTATAAATCT
ATATCTACTTCTATACACTATACTATACATTAGATTTTTTTCCCCCTAATTATGTCTTTTAATTATTAGCTTTATGACAATAAATTTTAATTAATGGCCATTATAGACTTTTGGAAAAAG
TCCTCTTCTAAATTATGAAGGTTGAATTAAATTTTTAAGCTTTTTTTTCTCATCCATTAAACTAATTAAACTAATTACTTTATTTGTCGGTTTTATTGTGGTATAGTTATGGGAAAATGC
TTTAGATAACNNNNNNNNNNNNNNNNNNNNNNNNCTACTCATAACATATTTTTCTTTTTCATAATGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTAATTAGATAGTAATCTAAAGAT
AGTAAATTGCTATTTCTTTCAAGCATTCCCTAATTGTGATATATTCAAATTCGAAATGAATGTGTTCAAAAGCAATTCTTCAAGTGTATTACATTTAAATATCATTATGATTACATTAGN
NNNNNNNNNNNNNNNNNNNNNNNNNNNGTGGTAAATGTTGGCNNNNNNNNNNNNNNNNNNNNNNCGAAAAAAAGGGATGTTTATGAAATGTTGGAGAAGTGAGAGATTTGAGCAAGCATC
TCCTCGATCAGAACATCGCCTCTCCTCTTCACAATCTCACTCATTTCTCTTACTTTCATCCTTAATTCTTCTCTGCGTTTCTCAATCACTACTTCTTTGATCAGTTTTGCAACTTCTTTT
CTTTGAATTTTGCCGTCAGGATCTCGTTTGGCCTCCACTCCGATCCCTGCAAATTCCACTACTCCGGCGTTAAATGGTTGATCTCCGAACACTGGAACTCCAATGATGGGAACCCCAGAC
ACAATACTTTCCAAAACAGAGTTCCATCCACAATGGCTTACAAATCCCCCAATGCTTCCATGCTTCAGTATCTTCCCCTGTGGAGCCCATCCTTTCACTACCATTGCTCTTTCTCCACTC
TTCTCCAGCAATTCTCTTCTCTTGATTTGTTGTTCTTCATCTCCTTTTTTATTAATCCTTTCAACCCATATGAAATTCGCCTCACTTTCTACTAACCCTTGTACTATTTCTTCCTTTTCT
TCCTCTGATGCGTAGCTTTCGCTTCCCAATGACACCAGAACCGTTGACAGAGCTTCCTTTTTGTCCAGCCAATTCTTGATTCTTGAATAATCTTCATCTTCTTCATCCTTCTCATTTGGT
TCGTACACCAATGGCCCAACTGGGATTACTTTCTTTTTTAATAGAAGGGAGAGATAATCCATGTATTCTCCCTCCACCTCTTTGAAGCTATTAATAAGAATTACATCGCGAGATGTATTA
AGGCATTCGAAAAAAGCCTCTCTGACGCTGCGGGCGTGTTCTGAAGGGGTAGAGTTGTACTTGGATCTCCAAGGATTGTGAAGTACAAAATCTGAGAATGGGAATTTAGAACTGGGGTGG
TGAATTGAGTGAAAGCCGTAGGAAATCATGGAAGTGCCAGAGGTGCTGAAATTGATGGCGGGTATGTTAAGGGAGGAAGCTAAGCGAGGAGCCCAAGACTGGAAACAGTCATAAATGAGG
AGATGTGGAGAAAGTGTTTTTAAAATTGTCTCAAAGAGTGGGGCGGCGGCAGCGAAGGCTTGGTGGAGGGCGGGCGTAAGGTGAGGAGGGAGGGCGTTGGTTGTGTGAAGATGGGGAGGA
AAGTCAGGAGAAGAAGGGAGATGAAGCTCCACAAATTGAATGGAAGGAGAAGGAATTAGCTTTGGTTTAATGGAGTCGAGATTAACAGGAGTTGAACAGAAATAGATGAGGAAGTTTTTC
CTTGTAGAGAGAGCTTTGGAGAGCTCCAAGTAAGGGGAGAGATGGCCATAGCCAAGCCATGGAAACATCAAAATGGTAGTGGTGGTTGGAGTTGAAGCTTGGTGGGCATCCATGGTCATG
CAAACAATGGGATGAAAGATTGGGATAACAAAGCTTTGTTTCTGTGGAGGTAGTAGAGAATGGAGAGGAGTGTATCTGTTACAACGTGCAGCACGTTGTATTGGTAGATCACGTTCGGAA
CTTAGATATTGACTTTGAAGTTGGAGTTATGATTGGATGTGGGCTGTGGTTTCTTGCTTCAATCACTTTTTCAACAAAACCTCTAATTTCCTTCTTCTCCAACAGATTGGAAGAAGATAA
TGTGATCTGAAAAGTGGGTCATTTGGAGGGAAGGGTAGTAGAGAATGGTAATGGAGAGCGATGATTTGATAGTCATTGACATTAAAGTAGAAATGAATATATAGTAAATGTGAAGTAGAT
GGATTTGGGACCTTTTTGTAATTTCTAAATTAAAATCACTATCAATTATTAAACCACTTCATGATATTAGAAAAATATTTTTGTGCTGCCTTATTTCTGTAAGTTATTCGATTAAACTTC
ATCATGTGGCAAATATTTCTTAAAACAAAATTGTTATTTTCTTACCAACAAAAGAGGTTGATATGAGATATGTTTGCATCCAATAATTATCATTATAATATTGTTTTTTTACCAATCATG
GCAATGCTCCAAATGTATTAGAAGGAAGCAAAGTTGTGGTGGGAAGTATTAAAGTTCTATGTATTTGATTTTGACGATCTATTTCATTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAACACAAAACTTGGTCAAATTTTGCCTTGAATTATCATGCGATATTTTATGAGCCCACTTGTGTATAA
TTGTTAAGAATAATTTATAATTAAGCTAAAGAAAATTTCTATAGGTGAAATTAGCCGAAAATAAATTGATAAAGAAAAGGAGAATTGTCAAATATGTGTGTTATGTATATTTTGAATGAA
ATGATGAGATTCAAGTGCATGAAGGTATAAGACTACAATTTGTTGAAGTTGATAGCAACACGTGCATCACGATGTGCTCTATTCTATAACACAATTTAATATGCTTGGGATGCACCATAA
TAACTATAGCTTGAATTGAAACGCATCTGTATATAAAATTGAAGAGAGTAGGCCATGACAAAAGTTCATATTTTTCCAAGAATTATAACAGATGTCTAACCTTGGTTCGTCCATCGAGAG
GCTTAATAGTCTGAGTCCTGTAATTGCTAAATTTGAAGCCTTGAAGTTAACAATAATAATTATATGATAATCTAATTTTATATTGGCTGCCTGCTTTCCAACTCCANNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTACATCCACTCCATTTGCTGCCATTCGCAAAATGACATTTGCCTTCTTCCTATAAGAACTTCTTGTTCTTGTTA
TTGCGGAGCTTAACTAATTAATCTTACTGTCATATTGCCATGGATGTTCAGAAATCTAGAGACACACCCACAACCATTTTGATGCTTCCATGGATTGGCTATGGCCATCTCTCTGCCTAC
TTGGAGCTAGCCAAAGTTCTATCTAGAAGGAACAACTTTCTCATCTACTTCTGTTCAACTCCTGTTAATCTTGACTCCATTAAACCTAGGCTAATTCCTTCTTCTTCCATTCAATTTGTG
GAGCTTCATCTTCCTTCTTCTCCTGAATTTCCTCCCCATCTTCACACAACAAACGCCCTTCCCCCTCGCCTTACGCCCACCCTCCACAAAGCCTTCGCTGCGGCTGCCTCACCCTTCGAG
GCAATTTTACAAACACTATGTCCGCATCTCCTCATTTATGACTCTCTGCAGCAATGGGCACCACAGATAGCTTCCTCCCTCAATATTCCTGCTATCAACTTCAATACAACCGCAGCTTCC
ATCATCTCTCATGCTCTTCACAATATCAACTATCCGGATACTAAATTCCCACTCTCAGATTGGGTTCTTCATAATTACTGGAAAGGCAAATACACCACCGCCAATGAAGCCACTTTAGAA
AGAATCCGCCGAGTTAGAGAATCGTTTCTGTATTGCTTGAGTGCTTCTCGCGATATAACTCTGATAAGTAGTTGCAGAGAGATTGAGGGAGAATACATGGATTACCTCTCTGTTCTGTTG
AAAAAGAAAGTAATCGCAGTTGGTCCTTTGGTATACGAGCCAAGAGAGGACGATGAAGATGAAGATTATTCAAGGATCAAGAATTGGTTGGACAAAAAAGAAGCATTGTCGACGGTTCTG
GTATCATTCGGAAGCGAATTCTTCCCGTCGAAAGAAGAAATGGAAGAAATCGGGTGCGGATTAGAAGAGAGTGGAGCTAATTTCATATGGGTGATCAGGTCTCCGAAAGGAGAAGAGAAT
AAGAGGGTTGAGGAGGCGTTGCCGGAAGGATTTGTGGAGAAAGCGGGAGAAAGGGCAATGATAGTGAAAGAGTGGGCGCCTCAGGGGAAGATATTGAAGCATCGGAGCATTGGAGGATTT
GTGAGTCATTGTGGATGGAATTCGGTGATGGAGAGTATAATGCTTGGAGTACCTGTAATAGCGGTTCCGATGCATGTGGATCAGCCGTATAACGCCGGACTTGTGGAAGAAGCAGGGCTC
GGAGTGGAGGCGAAGCGAGATCCCGACGGCATGATACAGAGAGAGGAAGTAGCAAAGCTGATTAGAGAAGTAGTAGTAGACAAAAGCCGAGAAGACTTGAGGACGAAGGTAATAGAAATG
GGTGAGATTTTGAGGAGTAAAGGAGATGAGAAGATTGATGAGATGGTGGCTCAAATTTCTCTCTTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCAAAATGGGTACCAA
AAATAATAAAAATTGTTATAAACCAAAAGTTAATTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAATCATATAACGTGTCTCCTCGATCTTGAATTATATAATCATTCT
TAAAAGACGATATTTAAATCCTCATTACATTTATACAATTAATTTGATTTTTTTTGTCAAAAAAGTTATTTTGATTTTTTTTTGAAAGGTATTAGCAAGGACGGATTTATTAGGGAGAGG
GGCACTCTCACATTATCAATTTTTATATTAATAGGCTTTCATCCCTTGTTGGGGGGAGAGATCTAGGGAAGAAAGAGTGGAATGAGTTAGGTAAGAAAGAGGTGCTGCCCACGGAGCGGT
CGGTGAACGATCACGAAAGATGTCTGAAATCATAATTATTCTTTCATTCTCGTTAATGAGAGCGCATCCCATGAGCGCAGCCCACAGAGCGGTTCAAAGAATATTGATAAGACTTCCAGG
CGTTTAATATTAGTTTTGAAGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTCACTTTTCTTAAATTTTCAAATCTCATCCACTACAATACATGNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATAGGGTATTTGATGCTCTATGTTTATGGAT
CTATTGCTGGTATTAGTAACTAATAGGTTTGTGGTTTGAAATTCTCGCACCCAAGTAGGTAACAAAATTGTATTGTTTAGGTGGCATAGTAATAAGAGTGGTAGATGAAAAATAGTTAGT
TAATAGTATTGATTAATAATTAGAGAAAAGTAGAGGGAGTGAAAAAGTGGGAAAAAGTGGCTAAAGCACACAACATTGGTGGATGCGTCGGTTGAGGAAGCCACGTTTTTTCTTATCAAT
GGACTGTTTCAGGGATTTCCTCTTCTTCCTCTCTTCCCGCATTGCTTCCATCCGTCTATCCATATCACAAATATAAACATAAATTACCCACAAAGCCCTTCAATTTTCAAACACAAATTA
TTTCTTCTTCCTTTCCTTTACTTTTGAAAAAACTTTGGACAAGGTAGAAGATGTTATAAAAAAAAAAAAGAAAAAAAACTTCCCACAAGCAAAATCCTCTGATTCGATCAACAAATGGTT
TCTGAGTTCATAGCATCACAGGTAGAAAGAAATATGAAAAATTAGAGAGACTACCGACACGAACAGCCATGCCAGACTACAGATATCGTTGCAGCAAAGAAACAGGATACTGAAAAGACA
GTACCACAAATAATAATGGAAACGAGAGAGACAAACATAGATAGTAAAACAAAATGGAGACAACCTAAATGGGAAAACAAATGATATCATCAACTTATCTGCCCATATCCCTCTTCATTT
TCAAGCAGATTAAGGTTTATAAGGTTTCAGTTTGATTCTCACTTGGCCATCATGACTTTCACAAATTCCTCATAGTTGATTTGCCCATCACCGTCAACGTCAGCCTCACGGATCATTTCA
TCAACTTCCTCGTCTGTCAACTTCTCACCTAGATTTGTCATTACGTGCCGGAGCTCGGCGGCAGAAATGAACCCATTCTGATCTTTATCAAACACGCGGAAAGCTTCCTTGAGTTCCTCC
TCTGAATCAGTGTCCTTCATTTTTCTTGCCATCAGATTAAGAAACTCAGGGAAATCGATGGTTCCATTTCCATCAGCATCAACTTCATTGATCATGTCTTGTAGCTCAGCTTCAGTTGGA
TTCTGGCCCAATGAACGCATTACAGTCCCCAGTTCCTTGGTGGTGATGCAGCCTATAAAAAAATGAAAAAGAAAGGTAGTCATTATTAAATAAAGAACAATAGGATGGGCTCACCATTTG
ATTATTTATCTAAGCAGAAGCAGTGACCAGTAGTTGCCAGCCCGTCAAGGCTTCATACACTCAGAACAAAAATTGAGAGGAATATGTTTCAGAAAAATGGAAATTTCAAAGATAGTGGAG
TAACTGAGAATGGAATAAAGTTCGACTGCATGTGTGGCTGAAACATGCAGTAAGTATAAACTTCCAGTAATATAAAATGCCAACAGGTCTAGGCAATCAATTCAAAACAAAAGCAAGGTT
CAAACACACGTTGATCATATAATTAGCCAGTAAATCAACTACTGCAAGAAAAGAATATAACAAACCTACCCAACAGAAATATAACAAACAAAATACAAATCACGAAATAAGTGTAAGGCT
TGACATACAGAAACAAACCAATACATGTTAGTCTTTTTTAGGTTGAGCAGCATGTAGTAGGAGTGCTTGTTAGGAATAGCATATCTCAAAATAGTAGCATGGTTGGATTAAATGCTATCA
GGAAGTCAAACAATCCCCGCAAAGTCAACATTTTATATGGAATGACCCACTTGGATGGTGGGTAGAGTACCAAAAAAATCCTTCCATGGTTGTCTCCTACAGGTAACGTCCTTGGTTTCT
TAGTGGGAGAAGACCAATATTGTTTTTCCACTCAATGTTCCTACAGTTGAAAATGTTGGGAACACATCCTTGTGCTCATTGTGAACTGTTCCAAACAGCTTCAGTTCTCTTAAAGACCAA
CGAATGTATCTAATTTAACCCATGCTTAACAATTCAGACTGGAAAAAGGAGATAAACAAAATAAGTAGGCCATCATTAGAGATAGATTTCCACTCAATGGAATGTGCACAATCAATTAGT
ATCTGCTAAATAGTATGCAGGGAACATGATCAAATTCATAATTTTTAAACCCAATGGGGGACTTCAGATGTCTTAGTCGCTGATTCTACGTACAGTAAACACTTCTAGACAAAAAACAAC
AAAGACACCAAAAGAGCAAGTCAAACCCACAAGATAAGGAAGCAAGAGAAACTAGAAGGCTGCAACTGCTTGCTTAAACAACTCGTACAGCTATGAATTCGTTAGACGAACTTTAACATT
AAACAAGTTCAAAGGAAGAAATTGTTATGATGGGTTAGCGTTGTTTGTATATCAGCTTTCTCTAGAAATAACCTGTTTATTACGCCTTTAATTATTTTGAAAACAAACAGCTGAATTATC
ATAGAATGAAGGACGGACGATAAAATTAGAGGAAAAAGTCGTGTAAATAAGATGATTCTAAATAAAATTCCAGGATAATTGCCAGATTTGCTGATCATACGATATATGATAACTAAATGA
ATTCCAAACTTCTACCTAACTAATTGACATGTCTACCATGTTAATGCTGACGTGCATGCTTATTAAAGATATTCAATCAAATGGTAACATGTATATGGAGGGTAAACAAGCAAACCATAA
ACGACCCGTTCCTTACGTAAACCATCTCAAAAGTCAAAAGATACAGAAAAGCAACGATCCACGAGTTATTTACTGCCTGACGAGGCGGGAGTATTAATATACGAACTAAAATGTAAATGT
AATTATGTAAATATGCATCATTATCCAGATTCCAAACTGTAATACACAACCTAAGAAAAATTTCAAATCGACATGGACATGGCATCCAATATCCATCCATCCATCCACGATTACCAAGCT
TCCTAATCACATAATGCTGATCGTAATCGACAATCCAATAGAACAAAAAAAAAAAAACGGAATCAAGAAGACCCAGGACAGGAACACGAAACAAAAACAAATAATAATCGTAGGCTGGGC
AATGATAAATAGGAATTCCATGAGAAAGAAAATAGATCTAAAATGGGGATGGGGGAACGAAAAAACATTAAAAAGAGAAAGAAGAAGGGGATCTGAAAGAAGAGAAGCAGACCATCGCCA
TCCTTGTCGAACAAACTGAAGGCCTCCTTGAACTCGGAGATCTGATCGTCGGTGAGCTGATCAGCCATGGAAATGGAAATTGATGAGGAAGGGAAATGAGAGAGGAAGGGGAAGGAGGAA
GAGGATGAAAACTAGAAGGGAGAGATCCAGACGCGGAGGAAGTCAGAATAGTAAAAGCAGAGAAGGGGATATAAATAGGAGAATCATAAACANNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNTGGTCCAATCTCGCGGGCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNATCGTCCATTCTCACAAATTTAACCAATTACTTACAAAATTAAGCAAAATTTATTTTCCATTCTATAAATAATGCACATTCATATTATTAAANNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGAATCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTTCATTTATTATTGTTTTTTTCTTCTCTTTTTTGGGATTAATTTT
GGACACCTTTCTATTTAATATATCTTTATCCTCTCCATGCTGTATTTTTAGCTTTCCAACTTTAGATTCAAATGTCGCTTTACAAATATGCCTTCTTTTTAACTTTTAAGGGAGTATATA
ATAAATAGTACATTTTTGTTTGATTGTCCTATGCAAACTTGCATATTCCATTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCTTATCATTCAACAAATGGAATTTAATA
TTTTAATCGAGAAGGTATTATTTTTGTTTAGTTATATATATAATTTCTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTATTTTAAAAAATGTTCATTTTCTGTGTGTGATGTTTATGTACGTTA
GTAAGAGCATAAAAAAATCATGTAATAGAATGATGACACGCCTCATATTGTTGAAAGTGAAAAAGGGAGAAAAAATGGCATTTTTATCGATTTAAAGTTTATTCCAATTTTTTTAAAATT
TTGACTATATTTGATTAGTTAATTTAGTTGCGGTTATCATAAACATATTTAATATAGGTTTAGACATCGAGTCCTTATTAACTTTATGTTTTTTTATATTTATTAGTATGCACTGGGGGT
GTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGAGTGGTTTAGAGTTTAAGAGAAATTGTGTTAATGGAAGAAAAGT
TTGTTGGAAGTAATAACCATACGTTGTTAATTATCTTTTTTTAAAAGACAACTCGTTATTACGAAACAATAAAAAGAAATCTTATATTCACTTTTTCATATTTACTTAATGCTTCAACGT
GGAGACTTCAAACATTATCATATTTTTATATCATTGTCTATTATTGCAAGCTTGAGATAATGATGTTTTTTAATTAGCATAATCGACTTTTATACAGTGAATAGATTTTATAGAATGAAA
AGTGGCTTAGATGTAAAAAGAAAAATATGATTGGTGTGAAATGTCTCAGCCAGTAGATGATTTTGTAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAATGAATGAAAATCT
AGGAAACTAAGAGAATTTTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNGACAATTTTACTATTGATATTATACTTAAAATTACCATTTTAAAATCTAAGAAGCTAAAAGGTTTTTTTGAATTAAAAAAAATAAAGTGTAATTAATATCCAA
TTAATGTATTTAGATTTTAATGGTTAATTATCTTAAGCACTTAGAGATCACTTTACAAATTTCTTATGAATTTTCATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATATCAATTTTTACNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGTGATAAAACTATCTTCCAACCCCCTCTAAATCCAGGTTTAAGCCCCGCTTTAA
AAAGCTTGTAAACTTATAAAAAGCCCTCGTTGTGTGGGCATAAACAATAAATGGCTATTATTAAATCACAAATGCAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTAGCTTCTATTTCTTGAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAATAAAGAGGAATTAAGTTTGGAAGTTTAGAATTATGGAGAGAAAATTTTTAGGAACAAAGTAGAAAATGCGGCC
AAAATTCTCAAAATGACCCCAACTTTCTTTTCGTAAAATGAAATGTGCTATTTTATAAAGAATTTACCTACAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATACAAATCTTCATTGTTGGAAGAAAGAAAGAACAAAGGACAACACGTTGAGCATGTCGGTTCCTAATTCAAAAATCCA
AACAATAATAATAAATCACAAATCCTTTCTAAACATCAATCTCATCTCATCGATTGAATTGTTCACTCTAGGTGAAGTTCAAACAGAACATGTTAATCAAATACACAACTTTCTTAGAAT
CAGATTCAATCATAGCAGATGAAAAAGAGATATATCAAAGAGAGAAACTCAATTAAAACATTATAAATTCAACCTACGATGGTCAGCTATCTAAAAATTAATTTCACTCGTGCTCGTAAA
CATAGCAAAGGATCTCTAGGTTGAGAGGGTATTATCGTCTTGTTGTGGAAAATAGTGCCATTAGCCGGAGAGTGGAAGCGGTAGTTTTGCAAGAAGGGAACTAAGTGGTGTCTGTTTTCC
AAATTCAAACGGAGGGAAAGTGAGTGGGAAACGGAACGGAGACGACGCTAACTAGTTGATCAGAAAATCCCACTAGAAGCTTGTATTCAGTAGATCGCCACTGCTTCCCACCGATCGCCT
CCACCTTCAACTTTGCAATCCACTCCCGCAACCATGGGTTCCGGTCTCTCCTTTTCCCATTCTCCTTATTTCATTACTTTCTTTTGTGTCACTTCTTTGATTCTACCACTGGTTAGGGTT
TTAGCAACTTTTTCGACTTCCTGCTGATCGACGCGTTTGCATTGCTTTGCCAAGATTTTCCTGTTTTAAGCTGATTAGTTTCTGAATTTGTAATTTAGATGATTGAAAATTTCTGCGTCA
TTTTTGGTTTGAATTATTGTCTTACGCATGGAAACCTAGCGGTTTCTTTCATTTTAGACGGGGGAGATAACGCATATAATTGATGTATCATCATTCGACTTGCTTGCTGTTGTTACCCAT
TCATAGCTTATCTGTTGAACATTACCCGGGAAAGTAATGAGTTTGTTTATCAGTTTACGTATTAATTAATGTATTGAACTGCGAGGGCAGATGCGGATATGGAAGATTATGGTTTCGAGT
ATTCGGACGATGAGCCTGAAGAGCAGGACGTTGATATTGAAAATCAATACTACAACTCTAAAGGTACCTGGAGTGTTGCCTCCAAGCCTTGCAATCACATTCTTTGTTGTTGTATTTTGT
TTTCCTGTTTTTAACAGCATCATTTGATCCAATTTGTTCATTAATAGGGTTGGTGGAAACGGACCCCGAAGGAGCTCTTGCAGGGTTTGCTGAGGTGGTACGCATGGAACCCGAGAAGGC
AGAGTGGTAAGTGTGGTAGTGAATTCCTTGTTTCTGCTTGCTAGATACTTGGACACAAAATCTATGCAGGCTCACTATCCAATATACTTTTTGTTCACTCATTCATTTTGGATATTTTGG
TGATAGGCTGTGTTTTATAAGTTCTTAAATTAGTGGAGTGATTATGGTAGTTTAACTTTATTTTTGAAACAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNCACTTTATTTTTTTAAAAAACTTGTAGTTTATCTTCTCGATGACTGGGTTTACATGCTTTTTGAAAATAGAAAAACTTGGATTGAAGGAAACATAATTTCT
ATTGTTGATCATGATCCTATGTGGCCTGGGATTCTTCATAGTAGATAATATGCCCCCTTAGATTTTATCCTGACTCGATCACAGCTCATTAGTTGCTCTTTGAAATCTTTGTTTGACAAC
CTCAATATTTTATATTCAATGCTTCTTCTGTGGAATTACTGTTAGATAGAATTGTATCTCAGTTCTATCTTTGTTGTTATGAATTTGTTCTCATTCCCTTTTTTTTGGATTTGCTAGGGG
CTTCAAGGCTCTCAAGCAAACTGTCAAGCTTTATTATAGACTGGGGAGGTATAAAGAAATGATGGATTCATATCGAGTGATGCTTACATACATAAAATCAGCAGTGACCCGTAATTATAG
TGAAAAATGTATAAACAATATCATGGATTTTGTATCTGGATCAGCAAGTCAGAGTTTTGGTCTCTTGCAAGAATTTTATCAAACCACTTTGAAAGCCCTTGAAGAGGCAAAGAATGAGGT
TTGAAAATGATTCTGGTTTTACGATCTCATGTATTCTCTAACCATGATGCCTTACATTCTGTTCTCTCTTGTGGTGCAGAGGCTTTGGTTCAAAACTAATTTAAAGCTTTGCAAGATTTG
GTTTGATATTGGTGAATATGGTCGCATGATTAAGGTGANNNNNNNNNNNNNNNNNNNNNNNNTCCTGATTTTTTTTGCATGTACATGGTTAATCAAATTCATTTTGACCTCAGATTTTGA
AGGAACTCCACAAGTCCTGTCAAAGAGAAGATGGTACAGATGATCAAAAGAAAGGAAGTCAACTTCTGGAAGTGTATGCCATTGAGATTCAAATGTATACTGAGACTAAAAATAACAAAA
AGCTCAAGGTAATGATCTGTAGCAATCCTTTTTTTTTTCTAGAGCTAGCTCTCAGCTCTGTGTTTCATTTCTTAGTAAAGAATTGCAGTTCACTTCTTCTTCTACCTTTTTTTTGTGTGG
GGGGGGGGGGGGAGGGTGGGAATTTTGTTGAGACAGTTGGTTCATCCTTGGTATAGAGATCTCACTATGGGTTGTGAAGTTAGATTCTTCAATTAAGAATAAGATGGTCATATTTGGGAG
GATTAAAACAATGAAATAAATGAGCAAAGAATGAATCCAACTTGGTTTAATCATCTTAATTACATCAAAACTATTGATAGATTTCCAAGAAGATGAAAAGACAGAGCATCTGCACATGGC
TAACCTCTCTCTCCACTGTTCTAAAGTTTTATTCAAAATTGGAATAATAGTAGGCTTTAGCTGATGAGCGTAAATTTTCTTCTGAAAGATCTTAGAGTGGTAGAGCCACAACCACAAACA
TAATAAAAGGCATATTAAGCAGCTTGTTGCAAGCCCAAGCGAAGTGGGGGGAAACGCTGACACAAGGTGTCAGCAGTTTCTTCTCCTTTTTTGTGCCAACAATTCTAGTAAGAACATAAA
TGGCCTGAATTTTGTCGTCTGTATTAAAATCTCCCAATGTAATGATGGAACATCCTTTGGAGGAGACATTACCTGGATGGAAAGATTCAATAATGGACTGACCTCTCAAACAAACTCTAT
AATAATTTCCCAAAAGACCATGATTATGCTAATAGATGGATCTGGGTTCTATTTTCTATCCCTTTGTTTGGCTGTGTGGTTTCTTGGTTCTTTATAGTATCTTTTGGAGTATGTGTTCTG
TCCCTTGAAGCTGGTGTGTTCTGCTATCAAATCCATCCCTTTGCCAGTTTTGTTAGACATGAGTCTATAAAGCAGCAGCCCAACAAGAGGTGCCTCCCAGAATTTAAACTAGCTATACAA
GAAAAGACCCCAGCCCAAAAGAAAAATGCATGAAGGAAAATTACAAAATTCTTTGAGAGTTATAGGTTACCTATTGTAGTTTTTACCTTCCTATATATTTTTTCCTCTGTTTATCTTTGT
TTGTCATCTTTCTCTGTCCCTATCTTTGCTGGTTAGTTGAACTCCCTAAAATGCTCTTCTTTTGCAGTATGTAATTGCTTTATTTTGATCTCAAATACTTTCCCCTTGCATTTGCTGGTT
ATTATGGTGCAGCAATTATACCAGAAAGCTCTTGCCATCAAGTCAGCAATACCCCATCCACGAATTATGGGAATAATTAGGGAGTGTGGAGGAAAGATGCACATGGCAGAACGTCAATGG
CCAGAAGCAGCGACTGATTTCTTTGAGGCTTTTAAGAATTATGATGAAGCTGGGAACCAGAGGCGTATCCAGTGCCTGAAGTATGCTCTCTTTCCATTTTCTCATTGTTCTTACTCATTA
TTAAGGCCAGGATTCAGAGTTATACCAAAACTGAATTTAGTGGAATTTGTAGATTGGACTCTGGCACCAAATACACAAATACTAGGTTCATAAATAACCAATGGTTTTTAACCAACTCAT
TGCAACACTTACAACTAAGCACTCTAGAAAACTCATGATCAATACGAGCTCACATTCAATACAGTTTACAGCTTGCAATTTACTTTTTCTGGAAGGAAACCAAATCTTTCGTTGATGTGA
CGAAAACTTCATGGATGTAGTAGCAACTTACAGCTACCAAAAAATTTAACTCCCCATTTATAATATTCAGCAAGGCAGTACTTTTAGTTCCGGAGTTCACCACCTATGGGTATCATTAGA
AGTTAAAGGGATCCTACTAGTCATGCTTAGGTTGTTAAATTTATGTTGCATTTAAGCAAACTAGCACATAGAATTGTGAAATGCTTTCTAATTCTCAGTGTCATGCTGTGTCTCTGGCAT
CCATTTCATACCATCTAATCATTTCTGTGTCCCCCCCACCCCCATAAAAAAAACAGATATCTAGTTTTGGCTAATATGCTGATGGAATCCGAAGTCAATCCATTCGATGGTCAAGAGGCA
AAGCCGTAAGTTTCAACCATTGAGCGCTACTTCGAGTTTACCATGTTCTCTCCCTTATCTCTAGATTGCAGGTATAAAAATGACCCCGAGATTTTGGCAATGACTAATCTTATTGCAGCA
TACCAAAGGAATGAGATACTTGAGTTCGAGAAGATTCTCAAGGTAAATTTGAGTAAGAGAATTATATGTATGCATTTTTCAGCTCTTCCCCTTCCTCCCCCTGGTCCAGTTTGGGAGTCG
TGGNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTTTACAGAGCAATAGAAAGACAATAATGGATGATCCATTCATTCGAAATTACATTGAAGATCTGTTGAAGAATGTCAGAACCCAAGTG
TTACTTAAACTTATCAAGCCTTACACAAGAATCCGGATTCCATTTATATCAAAGGTGACAGCTTTAGTTGCTTGTGTGGTTGTCTTTCCTATTCCTTTCTGGAACCAACTTGCATAATCT
TTTGATATCTGGTGTGGGGTTGAAACTTATCAAACTTTGCACAACTTGCCAAGTGTCATGTTTGTGGGGTTGTGAATGTGATGCGAATCCCCCACCCCTCAGATAGAACAAAGAAGAAAA
AAGAAGCAAATTACGAGTTTGTGTTTTTCCTCCCAACTTGTCCTTTTCAAAAACTTAGAGAATAGGGTTGTTACCATTGCTTAGATCCATTCAGATGAACTGAGAATCTATTGTGAACAC
CTTTGCAATTGTAGATAATATGTTATTAGGAATAGTTCAGATGCATCCATTTTTTATTCTAATGGAAGAAATATTAGAAAAAAAAAGAAGTAATTAGTCCAGATTATGATTGAAAGATGT
TTGTAACTATCAGGAACTCAATGTACCGGAGAAAGATGTTGAACAATTATTAGTTTCACTAATCCTGGATAATCGCATTGATGGTCACATTGATCAAGTCAACAGACTTTTGGAGCGTGG
TGACAGGTATGTTCTTTTTGGTTATTTCAATCACATTCCATCAAATGTTACAGAAAGTTGAAGAATATAAAGCGTAATTGGTAACCCCTGCAGGTCAAAGGGAATGAAGAAGTATACTGC
CATAGATAAATGGAACACTCAGTTGAAATCCCTCTTTCAAACTGTCAGCAACCGAGTATATTGATTCTTATTGCACAACCTAATTGTTGTTTCATTTACAACTTCACGGAGTGTTGAGGG
ATCTCCCGAGTCTAATTTTTTTTATGTTAAATTCTACGCCTTGTCTGTTTAAAAGCACAATGTGAAATGACACTGTAAACCCAACTGTTCTTTGGAAGCTCTATCGGATATCCCCAGTTG
CCTGGAAACGGCTACACATTATCATAAAAAACCATCCAGGTAAAGTCATGTATATAAAATTTAAACCTATTTTATAGGATAAGAAGGGGTCCGTTTGCAAGTCTAGATGTAATGATTAAG
GACGGTGGAAATGTTATAGACTTAGAAATGTTCTTGAGGGATAAACAACTTGATTTCATATACGGTATTCGAGAGCTTCTTGAAACAATAGGGCCGTAACTAAGGAGCACCAATTCTTTT
TCAGAACTTCGAAAAAATATACAAACAATGCATTGCATTGTGATTTTTCTTTTTCTTGCATTAGTTGAGGACAAAAGCCGAAAGAAGAATTTTGTCATGTTCTTAATTACTGAGGTGTTA
CTCTGTTAGCTGGTTTCTTCTAATGCCAAATTGTGGCCACATGTTTCGGCCGATTCAATTGGACCAAATCAATTAGCTTCATATCCTTGTTTTGTTTTTTGTTTTTAAATTAATGTTGCA
TTTATTATATAGGGAATGTGATGGAGGCTATTGGAGTTGTGGTGGAAGGTAATGATTTTTGGTTTTTGTTTGATTGTTTAGATATTTTACTGTTTTAGGTTTTCATAAAAAGAAATTTGG
GAAATGATCGATCTTAGTCTTGAAATTGGCTTGTGTTGTGCTATATTTGATTTTAGTTGGTAATTTCTATACTTAGGACTTGGTGGTTTATGCCATAAAGAATATGCCCAAAGCATAATA
CTACATCTAAAGATTTGAATCTGACACGACAGACTAAATTTTAGGAAAAGAAGAATTAAATGGGTTCTTAAAACGTAGAAGTAAGGTTATCAGTTACTTATCACCACACATTTGGTTGAA
ACACGAGTCTTCTTCTCCACCTCTTGATTCTCAATTTGTTTTTCCCTTTTGGCCAACCGTGTATGTTAATTTATTTATATCCAAATTTGTCACTTGCTTCATTCTTGTTCTTTTTATTGA
AATTTTACTTTAATTTGTGTACGTTAATCAATATTATGTCTAGTCCATTATTAGTGAACAGTGCTACTTTTGTCGGAGGAATAGCTTGATTAAATTGACTTGATAAGCTACCATACCCAA
TAAAATCTCTTGACGTATATTTAAACATCGTGTAATTTGTAGGGTCAATTGGCCTTTAAATTTAGTCCATATATAGTAGGAGAAAAGTTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTAACGTGCTCGATAATAATAATCAATGC
ACCTTTGTATGATTTAAGGAAATTGGCAAGTAGAGGTCACATCAGTTTGTTAAGCTTTTGCATTTTGTTGTCTTTTATTTATATAGTTCTCATTTGAAAATGGTGAGATACGAATTCTTG
CAAAAACACTGGAAAATACCATTTCAATAATGCCATAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAGTTTGAAATAGTTCAATTTTAGATTCTATCAACCA
ATTTGAATTTTTGTTATATTTTGATTTATTTGATTAAATAAACCTTCCAAATAAATAAACAAACAAAAATAGAAATTACAAAAAAGAAGAAAAAAGTGAGCTGCATGTGGAGGTCCTATG
CTTTTACAGTAGAGAGTTTGGATATATGCTCTAAGATCTTTGTCTTTTTGTATCACATGACGTTTTATTTAAGTTCAAAGACCAAAAACAGAGTTGAAAGGTTTGAAAATTTTGACTTGA
GAAATAACATGTTTAAATAAGTTGAGTTATGTACAGTTTAATAAAAACAGAATACTTATATACGTATCATTTGGTATCTAAGCTTTGAAAAGTTGTAATTATGTTGATTGATTAAAAAGA
AAATAATAGCACAACTACTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAAAAAAAATCAAGTATTAAAAGAAGAAGAAGCTAATTAATTAGTTGTAGTATATAGTTTATTGAATGATTTTAGTCAAAAGGACTAT
ATATTATATATATGATTTGATTAGGCATACCAAATAGACAAAATGATTTAAAATTTGCATGGAAGGTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAAGAAGNNNNNNNNNNNNN
NNNNNNNNNNNNNNAATGAGAAGAGAGGGGTGAGAATCGTAAATAAGTGTTTTATTTGGGTACAAAAGTGTAAATTGATGGAGGCCGTAGTGAAAAAAAATGAGTAAGCTGAGATGAGGA
CAAAATAGAGCAGAACTTGTGATGTCGGCTTTTTGCCACTGAGTTTCCTAATTTAAACATCATGTGGAAAAATTGAATTCTTTCTTTTCTATCTTTCTTTCTTAAGGTCACAGCTTGTTC
TTATCTAAATTACTACTAATTCTCTGCTGTTTCCAGTTTTGATTGTGGGAATTTGTTATATATTTAATTCTTTTCCCTCGTTTTCAATGCAATTTCTTCCTAATTTCCACCAACTATTAT
GTTGCTTTCAATGAAGAATGCGCAAGCTTAAACTATGCCCATAACTCTTAGATAGAGACTAAAACGGCATATACCCATTTCTGAGAAATGTGTGTATCAAGTTAAAAATCGATGGTGTAG
GTGTAGGACCCAAGTTTCAGCTAATAAATCTTGTACCAAGAGAAGTTAGCGGTGATAAAATCTTCCAGAGGTGAAACACCGCTTAGGAAGAGTTCCCGAGAGGTATCGTGGTGTTCTCTT
TTGTTATTTTTTTTTTCTGGTACTGTGTTGATAGAAGGTGGTCCAATCAAAGGGACCATGTCGTTTGAACTGTGTTCTTTTTACTGTTTGGAGAGGGTAATGTGTTATCTCTTTCGTTAA
TTTGAATTGGGTTTCTGAGGAATTTTGGGTTTATTTACTTGATGATGATGATTTTGGAGTGGATAGATATGGAGAAGTGATGTAAATGTGAAATGGGTAAAAGGGATAATTACGATCACG
TTCATGTTAGGAGGAAGTGGTTTGTCTGCTTCCAATAATCTATCTATCTATTTGCCTAATAAGTCCAGTGGTTGAGCAGGTGAGCTCGAGCTTCTCTGTCTTCTGCTTCTTTTCTCCAGA
ATTTGGCCTTTCAGCAATCTCAGGAGTCGTTAATTTCTGCTCTGAAGCGGCTACATAATTTCTCTTCTTCATTCTCACTGTCTGTATGTTATCTCTAACTCTCTCTGCCTGTCAGCTTGT
TGTCTCGCTTCTCCTTTCTCTTTCATACCACATATGACGTTGTTAGATTTCTCTCAAATTTCTTTTCTCGATTTCTCTGCTGCTGTACATACATATTTATAACTTGATTCATTGATAACC
CAATCACCCATTTGTTTCCCTTTTCTTATTCTTTTATTCTTTTCGACTTTCATAAACTTTTCCTGATTCGTCTTTGATACTTTGAAGATCTTGAGGTTGCTTTGGTGATTTCCTCGGATC
TTGCTTTTTCTGGTACTGGGGCGTCTTGATTTTATCTTGTTTGGTGAATTTCTTAGTTTTTAGGAAGTGGACTGATAACCACATGTTTGGTTGTACTAATCATTAGTTTAACATTTTTTT
TTCTCTTTGGTGATAGTCTTAGACTTTAGTTGCCATAAAATAATCCTTCCCTTTTCATTTCTTTTTTTTCAGGAGAGAGTTTGTACTGCAATTTTTTATTTCGTTTTTCCAATTTTCCAC
ATTTGAGCCTGCATAAGCTGTTGGTTCCCAAAGGTTAAGGAGTGCTGCGCACTTGTGATTGTTGAGTTGAAGGTGAGTAGTTATTAGTTTCTATCTTATTCTATTGTTTCTTGACTTCAC
TGTCTGTGAGGGATATCTCTGATTGCAGAAACTGATCTCGATTATCGGGATTACCATATTTAACTTTGTTAGATTTCAGTCTGCTTCTCATTCTTACAGCACTCGCTTATGACTAGGAAT
TCATGCAGGAACTTTGGAGTCTGTAGTTTAGTTTTTTTAACCGATATGTGTAGTTATTTAACTAGTTTTATGATCACAGCAGTTGTCAAGAGTAATTTCTTTTGGCCAATTAGTTTCCAA
GCACTTCACTGATTGGTTAATGTGGTAGTTTTATCAATATTGAAGTACCTGCCTCACATTTAGAATATATTTTCTTCGCCAAGAGTGGCAAGTTATGTTATGTTGTTCTCTTGCTCTATT
ATTGTTTTTTCACCCGAGGGAATGAACATGCAGACAAGAATTGGAACGTAGTCCCTTTTTTCTTCTTGTTAGAATTGTCTTAGGATTAACTGATCTCGTTGGAGTGGTAGCAGAGGTTTA
GTTAGAATCCAAGGACTGCGGCTCAAGGATAGAAAAGCAGCTTCTAACTATCACCGATGAAGAAAGTGCGAGGCCCTTACAGTTCTTAGTTGGAACTTTTTCTAGAGAATGAATACTATT
AGATAAAAAAGTTCTGCTGGCTTGACATGAAGAGCGATTTGTCAAACTTCCCAGATGAATGCACAGAGCAGTCTTGTATGCCCCTCGCCAATTCCAGCTAATATGAAGAGTTTTCTCTTT
GAACTTCTTGGAATAGAACAGTACAAGAGCATGGGTTTCTTTGAGAATTTAGTTAGACTTCGTTGTCTCTCCCCCCAATTACCATTTCTGACAAGTGCATGGGTTTCTTAGCCATTTTCA
GAAGAAGCTTTGGAAGGAATTGCTATAACATTACTGGGTATATTATCAATATTATTAGGATATTAGTAGTGACGTAATGGTGACTAGTTAGTGGCTTACTAAATTGTGAACGCCATGCTG
ATTTAGCTTGTTAATATATGTGCAAAGTAAGAATGAGGATCCTCTACCATGGTGGTATATATGCAAAGTGAAAACACATAAGCATTTGTAGATCATTAGAGCATTTTATTTTACAATTAA
TTTTAATTGAATCTTTTTTCCAGTAGGAAGTAAGTGTGACACTTTCTAGCCTAAAATTTGTTTATTGCTTATTTTTTTGAAACCTTGCATGATGCAACATTTGGCTGAACATCACTGTTT
AGAAAAACATTGCCTTTGGTTGCTCGTATACTTGTAGTTTGCTAAAAATGTAGTTGACTTCACACATCCATTCCTCTTGGTCTATTTTTCTGTTTTGTGTGTCAAGCATGGGAATACAAT
TGGTATTAGTTTAAACTTCAAATCACCCAGCTACATTCTCTTTAGATTCTCTTCATTCATTTTTTAGTTAAACAATGCTATGTGTTTAAATTATTAGTAAAATTCTTTACCTCTCAAGCA
ACTTGGTCCTTTTAAGTAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACTTATATCTGATATGCATTTGTTTAGAAAAGGGTGTTGGAAGATTTTACATCCAT
GAGAAGATCAGGTGTAAACCAACCAAAAGTCAAGCGTCTTGTTGGAAAATATGAAATGGGTCGAACAATTGGTGAAGGTACATTTGCAAAAGTGAAATTTGCCAAAAATTCTGAGACTGG
GGAACATGTAGCGATAAAGATCCTTGACAAAGAGAAAGTTCTGAAGCACAAGATGGCTGAACAGGTTTTCTTATAATCTTCATGGTCATAAATTTTTCTGTATTTTCTCTTCTGAATGTT
TATATAATAATTAAAATCCTAATTATACCTGAAAAGTTGTTGATGTCAATTAAGAAGATCAAAGGAAGATTGAAAATGGATGATTAATAATTGACAGGCACTGGCTGTACTGTGTGCTAA
TCTAGAGCCCACAAGAAAGGGGGAAACTTATATCCACAATTTAAGTTTTTGGGTTTAATTATAGTTTAGCAATGACAATCTATGAATCAGTGAGCTCTAATATGTTGATTAACCTACAGA
TCGTAAGCTTCCTTTCTTCTAATTGTAGATCTTCGTTTCAACCTCTTCTGTCACCCCCAACCCCGCCCTCTCCAAACAAAAAGAAAAATCAACATCCAAAAAGGAAAAAAAGAGTAGAAA
ATAAAAGAAGTAAAAAGGAGGGTGTGTAGTCTGATTCCTTATCAAAAGTGCCTTTAGATATAGGAACTTGTGAAGTTCAAAACAAAGTTAAAGGTTCTTAATGCTTTTACAGATAAAGCG
GGAAATTGCCACGATGAAACTAATAAAGCATCCACATGTCGTCCAATTGTTTGAGGTATCTCTCTCTCTCATCTTCGACAAAGCTCCTTTTCATTTTTTGTTCTGTATCTGCTAAAAGGC
TAGTCTAGAAGGCGGATTTTGCAATTTGAAGGTGATACTTGAAAATGGAGAGTGCTCTATTTTCTTCTGAGGCCATTTTCTTAACACAATTCTCAGAAGTGCTCTCAGCAGTTAATGTCT
GATACATATTCTTGTGAAGCTATTTTCCTTAACAGTTCTTTTTATTTTCAGGTGATGGGGAGCAAAACAAAGATATTTATTGTTTTGGAGTTTGTTACTGGCGGAGAACTTTTTGATAAA
ATTGTGAGTATTCTTTTTCTCAGAATATCCATTCCAACTTCTCTCTATTAGCTTTAAGTTTTTCAAGACCTCTTATCCAAGGTGGTAGAAACTGTATGTTCAACGAAAAGAGACAAAAAC
TGTAAGGAAGAAAGACGCCTAGAAAAGAAAGTAAAATGTTGTGCTATTGGCAAACTGATCCAGACCCGAATTCACCATTCTTTGGACCTTGGTATTCTGTTGACTTTTAGTTAAACTCAA
TATTGAACCTTCTGTGTTATTCTTGAAGGTAAATCATGGACGGATGAGTGAAAATGAGGCACGGAGATATTTCCAGCAACTTATAAATGCTGTTGATTATTGTCATAGCAGGGGTGTTTA
CCACAGAGATCTTAAGGTATCATCCATTTCATGTTCTACTTTCCTGAAATATAATACAGAAAAATGTCCAATGATCTGTAGTTAATTACCTCTGTGATGGTTCTTTTTTGCAGCCAGAAA
ATTTATTGTTAGATGCCTACGGGAATCTTAAAGTGTCTGACTTTGGCTTGAGTGCATTATCACAACAAGTTAAGGTAAGTTTGACCTTCCTGCTTTGAACGTAAAGCTCTCTAGTCAATT
TGTTGATCCTTATGTTAAACTTGATTGATGTCAAATATGTCAATTGGAGTTTTTGATTTGTATACTTCCTTTACTTTTGGTTGAAATGCCTTATAGCTCCTCTTTTGTGGGGTTTTTTCT
GGAGGATATATAATTTCAGTTTCCTTTATTGACCACACACGCACGCGCAAAGTAAAAAGAAAAGGCACTTGAGTCATAATAATTGAGTACTTGCCTAGGTGCAAGAATTGGGGAAAGCAT
GGACAAAATGTCGCTGCCAAGTGAAGCATTTAGTTTGCTCTCATTATTGCTTGCACAGCAGAGATACCACGGGACTTTTCATGTGCAGATGCTTGGTTTCCGTATTGGAGCATTCACAAA
GAATATGGTTCACGCTCCATTAAGTGCAACAGTAATAGCTGTGATTATATATTAATGCAAAATATCGAAATAGAGAATCTGGTGCCTCCCATTTGAGGAGACATCTTTCTTCACAATCTA
ATTTCAGAATTTGCCCAAGTCAAAATTTCTTAACCTTCCAACTCACATCGAGCGAGCTTAGCTTTTGAACTAACTAACCTAATTCAATAACCTTAGTATCTAACAGATGATTATCACAGA
TTTCAATCTAACCAAATATGTTCAAACCCAGTAAAGGGGTTTCCAAAAACTTCTTATCACTTCAGCATCCTGACTCTTGTTTCTGTAATTTTTATTCTTGTTTGCAACTTGGAAACTTTA
TAACATAATTCTTCATAACCATTCAGAAATATATGTATAAATACAGGACTTCCTATTAAATGATGTCACATATAATCGTTTCCCTTCCCTTTTCTTGGATTAATAATATTTTTTGATGAA
ATGGAAAGAAAAAATTCAATTTGTTTGATGTTGAGGTGTCCTTGGTGCTCTAAAAGAATATTTTAATTCATTTCTTGGAACATTTGGTTGGCAGGATGATGGCCTGCTTCACACTACTTG
TGGAACTCCAAACTATGTTGCTCCCGAGGTGCATATGCTATGCTTCATGAAATTTTTATATGTGCACAGCATTACTATAAGTGTCATAACTTTTAATTAACGTTTTGATATTTAGGTCCT
TAATGATAGAGGCTACGATGGTGCAACTGCAGACTTATGGTCTTGTGGAGTCATACTCTTCGTACTGCTTGCAGGTTACTTGCCTTTTGATGATTCTAATCTCATGAACCTTTATAAAAA
GGCGAGCATTTCTTTTTTACCTTTTCTTTACTTTTTTAAATTAAATCCTACTTCTCTTCACATTTGCATTGTTCACTTCTATTATATGCAGATCTCGGCTGCTGAGTTTACTTGTCCTCC
ATGGCTTTCTTTAGATGCCATGAAATTGATAGCCCGAATTTTGGATCCCAACCCAATGACTGTAAGCAAACTTTAACCGTGTGTACACTACATACAGTTGTTTGACTACCATGTTTTCGT
ACCTTTATCATAGATCATAGTTATTTGGATTGGATTACATGTTTGATTTTCTTCTACTGCAGCGCATCACTATACCAGAAATTTTGGAAGATGAATGGTTTAAAAAAGATTATAAACCCC
CTGTTTTTGAGGAGCAGAAGATTGCAAACTTGGATGATGTAGAAGCTGTCTTTAAAGATTCAGAAGTATGTCAGATTTGATTTCATTCTGAGCATTTCTCGCTTCCGAGTATTGTAATGT
TGCTTATGGCTTCTTGATGTTTATGAACTTTTATCAGGAACACCATGTGACAGAGAAGAAGGAAGAACACCCAGCAGCTATGAATGCCTTCGAGTTAATTTCAATGTCAAAGGGGCTCAA
CCTGGCAAATTTATTTGGTACAGAACAGGTGTGCACTTTGCCAATTATGAACGTTCAGTTACTGCAGTTGTGTCCCAGCATAAATTGATTGTGAGAGGGCATTTTCCCATACATTTGAGA
GAACCAACAGCATTTTACAAATTAATCTGCTTGATGCTATTAAGAGGGGAGAATAAGACATTCTAAAATAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGGACATTCTAAAATAATCATAATAAAAGAAGTTGTAATACCAAGAGAAAGCAAGATTACACCAAAGTGACCCTGAA
AACTGAAGGATCTCCCCATTATGGTTCTTTTCCTTCTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAAACAAAAAAAAAAACTAACCCTCGCTCTCGACAGCACAAT
TTACAAAGAACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAAAAAAAAATCCCTGCTCTGACA
GCACAATTTCAAAGAACTCTATAGCCTTTTCGGTAAAATGATGATCACTAGCTAAAATATTGCTTCAAGCTACTTGCTGTACTTGATCTTTGAGTGAAGCTTCCCGATGGGATCAACCCT
CTGTTGGGAGTTATTTGTAGTAGCTAGAGGAGAAATAAATGGAAGAAAACTCTTGACTGTGCCGCCTAGCAATTTTATGGTGTACTTATATTTATGTATCTTTTTTCTATAAAATGATTG
TCTATGAAAGTCTCGAGGAAATAATGTTGCAAATTGCCGGAGTGAGAATAGTTTAGCTGGAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNACTACAAAATATTATTGCAAATTTCTGTTTTTGCACATGGCAGGAATTCAAGAGAGAAACAAGGTTCACCTCTAAATGTTCAGCTAATGAAATTGTAAATAAGATCGAGG
AAGCTGCCAAACCTCTTGGTTTTGATGTACAAAAGAAAAATTACAAGGTGAGCTAACTCTACACAATAGACTTACTACTGAATGAATTTGAATCACAAGTAGCATATTTTCCTGCTAATT
GATATTTTGTTTAACGAATAATCATGCAAATTTCTCTATCAGATGAGGCTTGAAAATGTGAAAGCCGGTCGGAAGGGAAACCTTAATGTTGCGACAGAGGTACTAAATGATGAGGCATTG
TATACTTGAGAGGCATTGTGTTCAAAATAAAATCTAACATTTTTTTCTCATTTTTGAATAGATTTTGCAAGTCGCGCCTTCTGTCCATGTGGTTGAGATGCGAAAAGCAAAGGGAGACAC
TCTAGAGTTTCACAAGGTACTTCCTCTGCTAGTATGAAAAATCGTTCTTAGTCTTTATACAGTATTGATGGTACATGTTTAGAATCATAATAGACTCAACTTGACTAGTACACATACTAG
TTCTTTGGCAAAGTTGGTTAAAAGAAGTTATTTATAATGTTTTCATTGAAGTGAAAGATTAAATTATACAATTCATGTGGGTTTTCTTAGGGATGAGAAAGAACACTCTTTGTTTTACTT
TTGTAATTCTTATTAGAACTTTATAGTTACTTGTTCTTTGGAACTTTATAGTTATCCATCATCTTTGCAGTTCTACAAAAACCTTTCCACCTCTCTGGAGGATGTTGTTTGGAAGACTGA
GGAAGACATGCAAGAAACAAAGTGAAACTTGATGCAGGTCCAATTGTGAAGAACGAAATGTTGTAAATGCTCCACGACTATTGTTTCCTTACGCTCAAGTTCTCAACTCTCGTGTTTGGT
TGATTGTTTTCCGTTTTATTGTAGGAAAGCATGGAAAAAGCTCCCAAAAAAAAAAGAGCTATGACGATGTTTTTTATCGGACATGGGTTCTCAGTGATAGCAAGAAATGTTTGCAATTCT
TTTAGTCATATTATATGCTTTCATTAGTGTTTCAAACACAGAAGTGGCTTTCTTAATGCTCAGCTGTTCTCTTAAATGTTTCAGTTTGGAGCAAATTTTTATCTGCTGTCAACAAAAGAA
AGAAGTTGAAATATGTTGGGAAGTATAGAACTGGATGGGACTTCCAAAAATGTGCTTCAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAATAAAGG
TTGGGAAGTTTGACTGATAATCTGCCCTGGGCTTTGATTGGGTCAAAAAAATTGTTCTCTTGCTCTTCAGATGATTGGGAAAGTCAAAATAATGATTAAAATGAGTTTGTTATTTAATTT
ATGACGGCTAAATTGAGAAGTTGGCTGGATTCTATTTTTAAAATCAATTTTTGGAACTTGAAGTGTGAAAGCAAAAGATAATATAGCCTAAATTCAGGAGGACTAGTATTCTTAAAAGAA
GTGATCATGTTTAAAAGGTTTGTAAATTGCAAATAGAAATGATTGTTATGGACACGTTCTAATCATGTCATTCTTACGTGAGAATATACATATATATTTTTATTCATGTCAATGATATAT
AAAAGTAAATTATTCTTCAACCTTAGCTTAGGTTTCCAGGTGAATCAGTGACTTGTTTTGGTATAAGGATAAAAAATTCTTACGCCATTTTCAAATTTAAAAAACAAATGTAAGTTTGAC
TTTGTAAAAAGTGTACCATTTTAGAATTCAAGAATTAAATAAAACCATAATAAAAAAGAGGAACATTATTTTTCTAATTTTATATATCAATCAATCCTAATTTATTTGTCTTGGAGCAGA
ATTTAACTCAATTCACATTGTGTCAAACTAAAAAATAAACAAGAATTTAACTCAATTGTAACAACAAGTTTGACGGTGTAATTGGGAAAACTTGAAGAGAAGAGGAGAAGTCAAGGATGT
GATATTGTGAAAGGGACGGGAGAGTAAGAGTAAAAGGGGGGAAGTTAGTGGCGTGACTGAACCGTTTGCCACCACCTCTCAAAGAGACGCTTTTGAAATTTCAACGCAGATCTTTTTTTG
TTTTGATTTTGGAAAAAGGATGGCCATGGAGCATCAAATCAAAAATGGAGGTAGTTTTCAATTTTCATGGTGGCCCATCTTCTTGGATTTTTGAATTATCATTATCTAACACACATGGAA
ACATGGAGTTTCTTTAATTTCTAGCTTTGAGTTATTCAAACGTTGAACTCTTTCGTTGACTGTTGAAGCAAAGCTGGATGAGAGAGATGTTGAAGATTGAGGAACACTCTCTTCTTCTTC
CTTATATCTTTTTATTCTGTCTTTTGACCTTCCCCTTTTCCCCCCCAATTTTTTTCCCATCTCATTCTTCCTCCCTGTCCTTGTTATCATCATGGGAATCTGCTGCGCTAAACCTGCTAA
GCTTGCTCATGCTTCTTCCAGCATTATTTCTGGTGAACTCTCTCTTCAGCTCTTCCGTTTTTTGTACTTTTGTCCGCCATCGGTAGATTATTGTCAATTTTCATAGCAATGCGATTGGAA
AGGAAGCAATTCTCTTGTCAATTATCGGATCTGCATGCTGTTGTAATTTGGTTCTCTTATAAATTTCTAAAGTCTGTTGCTGTTAAGTTACTTGCTGGATGCGCTAACATTTCTATTTAT
ATTGTTCTAGCTTATATTGGGTATTGTGTTATTTGGATGTGAGTTTATTGTCTTTTTTATGTTGGGATTTCCTTAACTGGATCATTTTTCATGGCAGGAACGGATAACAAAAATAGTAAG
TCCAACGTGGAATCGATCAATTGTAATTCGAAAACTGTAAATTTTACCTCGAGTGCGCCTGTCATCAAACCGAAATTCGATGTGTCCGGTGCCTCTGCTCTCAAATCTTTTAGCTTCATT
GATCTCAAGAATGCTACCAAGAACTTCCGTAGTGAAAGTTTACTTGGTGAGGGAGGATTTGGATGCGTGTTTAAAGGATGGATCGATGAGCACTCTTATCTTCCTACTAAACCTGGAACT
GGAATTGTAGTGGCTGTCAAGAAACTCAAGCGAGAGAGCCTTCAAGGCTACAAAGAATGGCTTGTACGTAAACTATGAATTCTCTTATTAATCATAATATGTTTTCCAGATAACTCACCT
TAACTTCGTTTGAATCACATCATTTCAGGCAGAAGTAAATTATCTGGGCCAGCTTCGCCATGAAAATCTCGTCAGGCTCATTGGTTATTGCTCTGAATCTGATAACAGACTTCTAGTTTA
TGAGTATATGCCAAAGGGAAGTCTGGAAAATCACTTGTTTAGAAGTTAGTATGCAACCCCATCACCACCTCTTCAACAACTTTCTTCTCTTGCTAATTTTTAAAGCTGTTGCCTTCTATT
CATATTTAGATTAGTGTTTCCCTCCTCCAATCTATAGCACTTCAAGTCTAGCTATTAAAAATTAAGAATTGTCTAAGAAATGTATTATAGGGAACTTTTGTCATTGAAGCATTGTTTATA
CACAGCATGACTGAAGGAAGAAATCTTTTTGTTGATCCCCCGGCGATCAAGGAGCTAGGCTTTCTATAGTGGCACTTAGGCTGTTAATATCTAACAAACTTCTAGTATCCCTTTAATCAA
TTACCACAGTTAGTTCTATGGTACAATTATTGCCATCCGGAATAAACTAAACCCTTGCATCAATTCCTTTAAATAGTTCATTTATTTATTTTTGAGTGTGGTGATGCAGGAGTGTGGGCG
GGGCAAGTGGCTCTAAAACTTTTATGCTGAGGCTTCTGTTATAAGACGGACGAAACTATGTTGTTTCAATGAAATTGAGCTAGCCAAAAGCAAATGAGAGTAATTCCATGTCCATAGGAT
AATGAATTGTGTTAAGCCCGACGTAGGTTCACTTGTCAGGGAGTCAGAATAATGTTTGTCATTGCCTTTAGTTGCCACCTTGTTCCTCTTGACTGTGTTTTATTGCTATGAAGTACAACC
AGTTATACATGTTTTTCAAATTTTTGACAGGTTTCATGTGTTGTTTCGGTATTTTTATCTGGGAATTCGTAATAATACTCACCTTTCTCTGCTTTTACAGAAGGTGTTACCCCAATTTCT
TGGCGTGTTCGAATGGATATCGCAGTTGACGTGGCACGGGGATTGGCATTCTTACACAGTTCCGAACCTAATGTGATATATCGTGATTTGAAGGCTTCCAACATTCTGCTTGACTCAGTG
AGTGATTTTTTTTTTCCCTTGTCAATGGAAAGAAAATCCCTTCTGAAGATACTCATTTCTCTCTCTGTTTTTCCTTTGAAGGAATTCAATGCGAAACTATCAGATTTTGGCTTAGCAAGA
GAAGGGCCTACGGGAGATAAGACTCATGTTTCTACCCGGGTGATGGGAACTCGAGGCTATGCCGCCCCTGAATATGTAGCAACAGGTTGGCAGAATTCATTTTTTTCATCCTTTAATGTT
TCACAAATTGATGAAGTAAAACCAAATATTTAATTTCAGAAAGTACCAAATCTATTTAGTTCTTAGCTCATGTATGGAATGGTCGAACTTATTTTCTTGGTAAAGATTATTAAACTAAAA
ATTAAGAGGCAGAAAAGAAACGAAGATCCAAGATGAGAGAAATAGTTTTGTACTACATTATGCCCAAATATACTTTTATTCGTTCTTTCCTTCTATGTAGAACAAAGATATTTTTATTCA
GGAAATGATGCATTAATACAAGGGTACTGCACTCGTCTCTGACTTTGCTTGGTGATGGTTTGGCCAACTAAAACAGGTCACTTAACTCCGAAGAGCGATGTATACAGCTTTGGTGTTGTT
TTACTAGAACTTCTCTCAGGCAAGCGTGCACTAGACCACGAGAAAGTTGGGAGAGTTGAAGAGACCCTTGTAGATTGGGGCAAACCACTCCTAAGCGATGGTAAGCGAATGTTGAGGATT
ATGGATACAAGGATGGGCGGTCAATATTCGAGAAAAGAAGCTCAAGCTGCAGCTTCGCTTGCACTGAATTGTCTCCATACAGATCCAAAAAACAGGCCATCTATGGCCGAAGTTCTTGAC
GAATTGGAACGACTACACACTGCAAAGGATATTCTGGGGACCCCAAATGCTCATGCCATCAGACGAACTCCACCTTCTAGATTTCAATCATAATTTGTTTCGAATTGTTTCACCTGCCAA
CAAACGCACGTCTTACCTACTACACAAGATGTTCGATGTACAAGTTTTGTGGATATTTCAAGTAGAATATACACCCTAGAAAATGTAATCAACACTTACATTTATATATAGACCTTTCAA
GTCTCCATATGAGAAATTACGAAATGGCATATGATAAAAAATGTGCACAATCAATTGAAGTAAACAAGATCATTCAGAACATGCCCTAATAAACAAGACTACTAAAGAACTAGAAATTAT
AAGAAAACAAAAGTCAATTAAAAAAAACAAACAAACTCTGAGGGCACATTTTGATTTCTAAGGTTCAGTCTTCCTGGTCAGCTGCCAAACAAAATATTAGAAATCTCATTTACGGGAAGG
TTCTACAAGGAACAAAAATACTTTGCAAACGCCTGTACTCACTGTTCACAACTCATCTAATCTATTAGAACATAACTAAAAGAACCTAATTTCTCATTTTCTATAAAACATTGTAATGAA
AAATTACAGGAAAAGCTTGTCCACATGTACATACATTGATTTTAAGAAATGAGCTTAAAAGAACCAATGGCTTAACTCTAACCATTTCTATGCTAATTGGAGCTGCCAACTCATCTCTAG
CGTGATAATTATACTACGGAGGTGGAGGCTGGAAATGCCTAGAGCATGCTTGATCAATTACGCACTTCCCAAAAGGCAAAATGCAATTACAATCATATTACCACTATTGCTGCCATCCAT
ATTGTTGGTTGCGGTTTCCGCCCATCACATTGGAGCCACGACCAGTACCAGAACTACCAGGATATGGACCATTCTGTGGGTAATTTGGAGCCCCCACGCCATAACCACCACCACCTCCAG
CTCCTCCTCGAGGACCAGCACCAGACATGCTACCAGACCCATAGGCACCACCTCGTCCTTGAGCATATTGTGTGTTACCATAACCACCTTGACCACCACGACTTGAGTGGTTGTATCCAG
AAGGGGGATTTCCACCAGGATACCTACCAGGACCTGGGGGTCCACGAGGCTTTACAAAATGATGGCTAGGCCCTGCAGCAACTGGTTGTTGAGACCCATGAATAGGTTGGTTAGGTACTG
GTCGCATTTGTGCGTGTGCTTGTCCAGACTGCTGAATAGGTGGAAGGCGTGCATGCTGTGGGTGTTGCAACTTCTGTCGCTTTGCAGTTTCTTCATGTTGTCGTTGCTGTTGACGCTTCT
TCTTTGTCTGGAACTCGTGTGATGATTCATACTTAGGCAAACTGGATACAAAGAAAGCCTTTAGATATACATTGAAGATTAAACGAAAATGATATGGTGTCAACTAAATAACTTCTTACC
TTTTAGGATCACAAGGCAATGGATCTGTCCAAAAATACTCCGCATCTAGGGCATCCTTGGCAGATATCCTCTATATTTATAGTGAAAAAGACGTACAAGAGTCGGGATGCAGATAAAGAA
ACCAAGAATATGGATCAAATAGGAATAGATGAGGATATATTGAATTGCTTTTTGGAGCCTCCAGACCCTTGCCTAAATATATATTTACATCCCTCATGAAAGTAAAAAGCTATTGGGTAT
GTGTTACTATACTACCAGTAATATAAACATTGACAGTGTTAGTGAACTGTACTACTAATAAAAGCATTAGATAATCATAGTCACTCACGAGTTTCTGTCTTATTGCACACTCAATCTACA
AATGCATATTCCTGCCCATGGAGTTCTAAGAATTTTTTGAATAGCACCACAGTTAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNGACATAAAACTAAACTTCTTAATCATAGTTTCCTTTACTTTCTTTCTTAACCAAGGGTCCAAATGGCCCCTACACAAGCATTAGTTCCACTTTTGTATG
CGACCACCGGGGACGGTGCAGCACATCATACTAAATTGTAATAACGAGTTTTGCATTTACGGTTTGTCCCAAAATTATATTGAACTGAAAGTGGTTAATATCTATACCACAAATATCAAA
AATGAAAAATAGAAAAAAAGATAGACCAAAGTGATACCTGGGAAGGATCAAGTGTAAGCATCTTCTCCAACAGTTCTAAAGCATGACGATCAAAACTATAAACAAAAATATCAGACCCAT
AAATGATAATGTTATGCTGATGATATGAACTGCAACACATTAAAAAGGTAAAACAACATCTGAACTTACTGCCGGAAAACTTCTCTAATACGTCTCTTCATTGGCCTCGTGGGCTTGAAA
TTATTGTACCAAGGGATTTTAGAAACCCCAGGCCAATTGACTTCATCCGGAGCACCACACAGCTCAAAAATCTTGTTTAATTGCTCCGGCTACAACAATTAACAAAAGGGCATAAGAATG
CCTGTTTTAACAAACTCATAAGAACCAGACAATTTGAGGCTTTTTAACTTTTAAAGCTCGAGGCACAGAAAAGGGTGTAGATCCATTTCAAAGGGGCACNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAAACTTGCAGGCAAACAAGGTTCAAACTTTCTAAACTTGATAGCAAATTTGGGGA
AGACAAAGAATCATAGAGAATGGGCAGGAAGCAAGATTTGAAATAGGAATGTGGAAGCAAAAAACATCAAACTTAACACAAGAGTTTCCCATTGAGGGTTAGCAATTTTTTTTAGAAGCC
CTAGGAGCACAGCTCAAGGGATTTTTGCAACTATATTATTTGTTTGAGCCACATTATATTTGCACGTGCCTGATATTTGCACGTGCCTGATAAAGAAGTTTGACCTTGTGTAAATATAAT
ACAGGTAATAATTTACCCAAACAATCAAAATAAATATGAAAAAGGGCATATTACGACAATATCGAGTCTTACTTTTCTTTAAGCATAAAAATTGGCCGAAAAGCCCATACCTCATCCTTC
CCAGGGAATATTGGCTTCCCATGTAGAAGCTCTGCAAAGATACAGCCAACAGACCACATATCTACAGCTGGACCGTATTTGGTTGACCCAAGCAGCAGTTCAGGAGGTCTGTAAGTTAAT
GACAATTAAGACTATGTGCAACCAACATCCTTTTATTTGAAAGTCACACTTCTGGTGATTGAAACTTGAAAAAATAAATGTATGTATGAAAAATGCAGAAAACTGTAGATGATATGACAA
GCACAAGTTTCTACAAATTAAAGTAGAACTTTTCGTGATTAATAGAGCTATATACCTGTACCATAAGGTAATGACACGATTTGTTAGATTTGCATTGTGATCATTAGAAAATGATCGGGC
AAGCCCAAAATCTGCAAGCTTCAGATTTCCTTCGTTGTCAATAAGCAGATTTGACCCTGCAGCACAAACATTATAATAATAAACTAAACAAGCAAAAAAAAAAAAAAAAAAGAAAGATAT
CCATGAATATTGACCTTCAAATTACCTTTTATATCTCTATGGAGTACTTGATTTACATGACAATAGTGAAGCCCTGTGAGAAGCTGCCTCATGTAACACTGTCCAAAAAAACACAGCAGC
CATAATGCTCATATACCATGAATAGCTATTGAAAGAGGAAGAGGATGAATCTTTTTTGCTAATACCTTGATTTGAGGAACTGAAAATCTCATCCCTGGACGATCAGCCAGGCCAGTCAAA
TCATGGTCCATGTACTCAAAAACCATGTAGATTCCACCTTTGTACTTATTACCATCTGCACAGCCCAAATAAGCTATACAGTAAGAACTCATCCTATTCATTACACTACAACTTATAAAG
GATAGTTTGTACTGATGCAACTAAATTCTGTTAAAATGAAATATATCGCATTGAAGCCATGCTGCAAATGATGATAAGGTACATGCCTGGCTTCCCTTGTTCATCCTTCTCAGGACCTGA
AAACATGCCAAAACTTGTAGAATTGTAAAAATACAATAATAATAAAAAGGAGTAAAAACCCGCAAACTCATTAAGTATAAATCATAACAAAGCAGGTGAAATTATAAATTATACCTGGAG
ATGTCACAATCTCTTTCAGCTTGATTACATTTTCGTGATGAAGCTTCTTTAAAATTTTGATTTCGCGTATTGCAGTAATAGGGAACTACACGGACAAATGAACTGAATGTCACATCACAG
AACAAGCATATAGCTTAGATAGAAGTTTAACACTAGGAAGAGTTATGACGTAGAGGAGCCACCTTGAGTCTAAAACTTAAACAAGAGTTATCATACATTCATCAATTTTTCAATTTTCAA
GTCTATAAAAACCAGCAGTCGAAATTTCAGTATTCTCGTATAATTGCAGGGCTAACAACAATGCGTACTAACAAATATGAACTATCCACCTAAGCAAGATGGAAAAAAAATAAAGTGAAT
AAGAAGCATACCCCCTCCCTTTCATTATCCATTCTTATTTTCTTCAGTGCAACAATTTCACCTGTTTTCAATTCTCTAGCCATGTAAACTTGACTGCAACCACAGAAGAATAGTAGCACA
AATTACTCCAAACATTTTTTAATAAACAACTGCTATAACTACCAACAAAAAATAAACGATCACTGACTTTGCACAGAAAAGCTATTAAAATGTTTAATTGGACAAGGGGAAGTTCTCAGA
TTGCCATGAACACTGTAGTCAGAAGCATGCATATAATTCATATCAAAGTGAGGAAACCACCTTCAAGGAAATTATTATTTATTGCACACCTAGAACATGACTATGTCTAAAGTAAAGTAG
AACTGACGCAGTTAAGGAACTATAAAGAACATTATTACCTTTAGCTGTTAAGTCCAGGAGAGTTTGGTTTGATGGAAGAAAACTTCTTTTTAGTTAGTCTGACCACACTTTCAGTGATTG
ATAATGGTGCAAAGCAGTTTGGTGTTTGTTGAAAGATCTTTAATATTCTTAGCCCATTGCCATTATCTATCTATGTGTATGTGTTTCAACATGTTATGGTTTTCAATCTAAGAAATAGAG
GTCAATAAGACACCATAATGTGTAGACAGAAAGATGTTATCATGTTACAGTATTAGTTCAGATCTGAAACGGCGTCTTTTCCAGATTGCATTCTTATCATTTTCTTCGACCAGAAGCATT
AATTCAATGAAAACGCATTTCAAAATTATACAAATACGTTGGAAACCGACAATTTGATATGAGACACACGAAAAAAATGCGACAAGCTTGTGTTCGATTCGATTTTCATTTCATAACTCA
AATTCTGGTACACAAGAATTGTTTCCCAACCACGTAAGAGCATGGAGGAATATATCAGTAAATACATATATACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCG
ATCAATGAGGTATGACATAACAAGAAACTAGAAAGTAAGAGCCAATAAAGATTTCCAAATCCCAACAAGAAATGACTACCGCAGCGGATAAATAAAATAAGGCGGAAAAGGGTATAGGCA
CAAATAGCAGACCCATAAGTGCCTTCACCAATCTGCTCCAGTTTTTCAAAGCAGTCGACACTTCTAGACCCCCAAGAAGGAGATTCGTTCACGTTAAGCTGCCCTGGGGCTGTTACAGCC
ATAGTCTTCCCTTGGACCCGTACTCTCCCTTCCCTGAAGACCCTACTACCGGATCAAATAATCAGCAATCCGAATGTAGCATTAAGCGTAGAAAAGGAGCGATAACACAAATTTTTTCAA
CTAATCGTCTAGAGGGAGGAACCCCAAACCAAGATTTGTGGGGAAAATAAAGTAGAAATCACCTGAATTGGGAATTGAAGTTAGGAGTGAAGAGAGTAGACGAACAGCTGGAGAATAAAG
ATGGTATTGAGAAGGTCCGTAGTCAGAAGAGGCGGAAGAATATAGATGAGCGAGGAGAGGAGAGGAGAGGCGAGCCCTATGGCAGCGTTGGCACCAAAGATTCACCCACAGAGTTGGCGG
CGTGAGGTTGAAGCAGGGATAGTTATAGAAAGAGAAGAAAGACAAAGGGCAGCGGCGAGGAGGGTGATCGGAGACGAGAAAGAAATCGGAGCGTGGTGCCGGTGAGGGCGAGCGGGTGCA
GCAAAAATGGGAGAAGGAAATGAAAGCAAAGCAAAATTGGGTGTGGGAATGGGAATAAAGGTAAAGGGTTTTTCCTTTTCTTTTTATTTCACGTGGGAACCGTGGGATTTTGTGTTTTGG
GGATTCTAACTTAAATAAAAAAAATATACCATTAGTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTCTCTTTTTCTTTAAAAAAACATTTACTAACGTTGGGATCTAAAATGTTATTGACTTGTTGTTGCCTTAAGTGCTAATTCTG
GGTTTTGAACAAAGTACCTCATTGGGAGGGATTTATTATCCTCTTATTGGTCATGTAAGAAGGATTCGATTTAGTGGTTATAGCATAAAACATTTGTTTGAGCTGAGACTTGATGAATAA
TATATAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNAAACTTTGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAA
TTACATGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTCAACATAATTTTAGGGATAAAATAGTTATTTTGGCCTT
AGTCAATTTGTGAACAACCTCTACACCTTAACGTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNTTTATAAAATAAATTGTTAATAGTATTATATGTGGTTGTCAAACTATAAATTGATTGAAATTTTCTATTTAAATAAATAGTTTTGCATGTGTATCAGTTACAAACTTA
ATGAACACCGAGTAATTTGCAGGGAATCACCTTGAGTTTGTAACGCTATCTCTACTTAAACACTCTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNTTGTTACATTCATGAACAAAATCACACAATAACTTGCCATGAATTTTAGAGTTATGACATGTTTTAGTCCTGAATATTAATATAATTAGGATTATAT
TAGATATTTTTGTTGTTATTCACTCTTATATGTTGTGACTTAAAACCATGGACGTTTCAAAATTTTCAATTATAATTCAACATTTTAGTTTTTTTCGTTTAAATTTGGAGGGTTTTTTTT
CCAGTGATGGTTTATATATAGGTTAATAGTGCTTCCTTACGACCACATCCCTGTTTTGTGTTTTTATTTAACAACTAATCTGATACGATGACAGTGTTTGCACATACCATGCATTTTTTT
CCTCATTCGCCAACGTGCATTTTGGCTATTTCACTTTGACACCTCACTCACATCTCTCTTTCACGTTAATCGTTCTTTCATTCATTTTCATATTCTCTTATTGTCTATTTATTTGTCTTT
ATATTTACCTTCAAATCACTATCTTTATGCTGACCGTTAAGTCGAGAAGTGAGGGTATTTTATTTGTAATTTGAATTAATATGTTGTTGTTTTTCTTTGTTATCGGAAGAAAATGTATAC
ACATTCAAAGTTTCGTAAGGGTTAAACTAGAAAGTTTAGAAAGTTTTAATTACTATTATTTTTTAAGGAAATAAAATTAAAGTTTAACCGTAATTAAAATTAAAATCTCACATTGTAAAA
AGGAAACTGAAAATTACAAAGTAATTTTGAAAAGTTGGAGTGGGGNNNNNNNNNNNNNNNNNNNNNNNGAAAGAAGAGGGGGCGATATTTCACGCCGTTATGAAAGCGGATATCATTCGC
CAAACTTCAGTGAACTGCGGGGTAACTCTCACACATTTTTCCTCACAAACTCCTTTCTTCTCTTCTTTAGTTTTGATCTAATTGAAGAACCCTTGTTTGAATTCTTTTTTTTTTTTTGTA
AGATTTAGTTGTTTCTGGATTAGGGTTCACAATGCCAGAACTGAGTTGGAGACATCACACTCTCATTCAATCGCTACTCTCTCGCGGCCCACTCAGAGAGGATCAGTTTCATTTGCTGTT
TAAGCAAATCACTGGAAAAACTCCAGGTTCCATTTTCCTTCTCTCTCTTNNNNNNNNNNNNNNNNNNNNNNNNNTCTGCTTGATATCCAAGTTCATGATTCAAACCTACGAATTCCTGCT
CCATTATGTCTTACAAAGGATGTAGTAGCGTTTCTCAACAAGTGACTTTGAATCCTCACAAATTTCTATGCAAATGCCACATAATTGTTGTAATCGAATGGTAATGCTAATGGAACCACT
TATTGGAAGAAATTTAATATGGGTTCATATCCGTGTACGCATTGGAATTGTTTATCCTCTTCGGAGGTTGATCCTTATAGAATTTATTTTTTCCAAAGGCGATAATCAACACTCTTATAG
ACATTTCTCCATCCTTAACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTG
CCTTAATCAATAGCTTTATCCATTGTAAATGAAGAGCATCTTTAATTGATAATTTTTCTGGGAAACAATATACTAGCAATACTTATTTAAGATGATGGTGAAAGCTTATGTATGTCTAAT
GTTTGTCTCGGTGCAGATAATGACCAGCAGGTTTTTAACAGTTACCTCCTGACTATAAATAAAGCACTTTCTTTTGCTCAGTTTGAGTTGAGAGGCTGTAGAAACCAATATGATGGACGT
GTTTACTATGGCTTGGTAAATAATGTATCTGACGACCAATCCAAGCTGGGAACAAAGTATTCAGTTCCACAGATTGCCCTTTTTAAAGCCATCGTACGTGAGGTTCTTCAACCTTTTCTT
CCTATTTACTGTTCAGATTTGGATATTGATCAGATATCTGTTAAATAAAGATATTGAAGTTGTCATCATCTTCATTCTTATTGGATTGGCTGTGAATGTGTATGTTAGTAGATCAAACGT
GAGATTCAAAAAAATGTGGAAAAGTGAACCTCCCCATTAGCCAAATAGTTGCAAAAAACTCTCTATTGACTGTTTGACTGTCAAAAGAAAAATGGCTAAAAAGCAGCTAAAGAGAGTACA
CAATCTAAAAACCTGATAGATAATTTTATCAATAGTCTTTTGCAAAGTATAGGAGGCTTCCTTGACGTTCATTTCCAATCCAATAACCAAGACTATTGCACCCTGCCAAGAGCCTCCAAA
ATATAATGATCTTATCAATGAGTCCATTGCAAATGATCAGTGGAAAGATGCTCTCTAAATTCTGATCATCTTGGGTTTATATTGTTTGAAATATGTTATAAGTTTCTCATCTCTTGTAAT
GATTTTTTCATTGTAATCTTAAGTATTTTGTTTATTCTATCACTGTTATAAGCCCATACTCGGTTAAGTTGTTTCAAACATCCCACTCAACTAACAACTCATTCGCCAACTCTCTCCGAG
AATTTGGAGAGAGGAATGAGGGGTAGCTTCTTCAGAAATTTGATTATTAACTACACAGGATTTGGTAATGGTGACTTTAACGGCTTAGGCTTATGCTGCATCAATTATTGTATTATCAAT
AATGGGAATTGTTGGAGCCCACAATAAACCGCCTCTTCTGCTAATTTGCTTAATAGTCAACATGGGAGCTTAGTGTTTGCATTACATGCATTTTTTTGTTGTTGTGTCGCTGCAGTATTT
GTTAAAAACAAAAGGAATTGCTTTGTCAGGTTGAAGCAATTGCACAAGATTCATCTGCTCAAGGTGGAATATCAAATATTTCTGCTCTTAATCTGCAGCTGGAAAATCAGGTTTCCCTTG
TTGTCTTTGACCAATACTTCCATTTGTCTAGCCCAATTGACTGAAGTGTGATGCCAGAATTCTTTTAAGTCCATTGTCAAAGTCGGCTCCATATTTAACTGAACTTGGCTTCTCTGGTCT
TTTGCTTTATAAATATGAATATATGACTACCTTCAGTTACCGTGTACTGTGGACAGGAACATTTTTCACGTTTTTCACGTTTCTTGTGGAGTGATTTCTTTGGAATGAGTTCCACAAGAG
TATCAACTCATATTTAGATTATACCATTTGTAGATTCTTGAATTATGATTTTATGCTAGCTTCGTTTTTCTTAAACTTAGATATTGAGAATGAAGTTTTTAGAGTTTTCTACATAGTAAA
TGCTCCTATCTTATCAACCAAATTGGGATATTGGAACTGTTGGTCTGACAGTAGCATAAATGACATTCGCAGTTTTCTACATGCATTCAATTATTTGCTATGGAGTCAGTCTCAAATTTT
TTGTTTTTACTTCTTTCTTTTCTGATACTTGATTGTGTATAACTGTTAAATTTAAACCAAGAGTTTAAGGCCGCTTTTAAATTCTACACAATTTGGTTGCAAGGCTTTTGATTTGCCAAA
TTTCACCATTGTGGGTAAAGTTGAAAAGAGAACCAGCAAACGTTCCAGCCCCTTGTATTTGTATCAGTGTATGCATTTATCTGCTTCTTCACATATTTAAGGGTTCTATTGTATAATACT
CATGTGCATTGTTTGACTATTACGGTTTTTAACTGCCAGCTGGGGGATACAGGATCCCAGTCCCAAGTCATACCAGCTGCTTTCAAGAATTTCTCAAAATCTCACAAGGAAAAAACAATT
GCTGAGCTTGCTCAGGATAAGTGGCTTGATTGCACCCCTGATGGCTTTGTAAATTTGGGCGTCCGATCGTTTCTTGATTTGCGAAGTTGGTTCCGCAGCAATGATGTACCTTCATGTGAA
GTGTGCAATGAAGCTGGAGTGAAGGTTCTCTTCTTGATTGGAGACCTCTCTTTTTCCTTTTCTTGTGGGCTCTATTTTTATGTCCTTTCATTCTCTCGTTCATTATTAAAGAAAGTTCAG
TTTCACATAAAAAATAAGCTTTGTATGCTGCATTATTTTACTCAATGCCCCCACTGATAGAAGAACCTAAGCTCCATATAGTTTTGCTGTAGAGACCGATAAAAAAAATTATCTCCTTGA
TGATTTATATTTTGTTGGGCTTGCCATTCACAGGCAGAGTTGTGTAGTACTGAAGTTTGCACTGTCCGGGTCCATCAGTATTGCCTTAAGAAAATGTTATCCAATAAAAAGGTAACAGTA
ATATGATGTGGTACCGCGCATTTAAATTTTAATCAGTAAACTCTCTCGGGCCTAATAGTTCTTTCATTGACTACTATTAGAGTAAAAAGGCCTGTCCAGGTTGTGGCACTCGATGGCAAT
CTACAACGTCCAACATAGAGCCCAAGGAGGAAGAGGATGAGCCGGATACACGCACTCAAGATCAACCATCATCACATAAGAGGAAGAAATCCAGGTTGAACGTAGATATTGATTTAGGAC
CAAACGAAGACAGTACCGCAGAAGCTTCCCAACCTCCTCCTACAAGGAGAACAACACGAAGTTCTGCACGCCAGCGGTAGGTCTTGGAATGAGGTGCTGTTATTTTTATACAGTTTCATG
TATACTATCATTAGTTTAGGAGTTGTAAAGTGTGCAACAAAAGCACTTTTTGATGTCTTGTCGAAATTGTCACCTTATTTATATTTATTTGAAGTGTCATTTTGAAATCTTTATACCCAA
AACCGGAATGCAAAGTGCATTACAGTACGTAAGCCAGAAGTAGAAGTTTTCTTTTACCTCCCCTAAACTGTAGCTTTGGTTCTCCTTTCTTGTCCTCTATAAATGCAAGGAACCTGCTCT
TCCATTGTAAGTATCCAATTTTTGTGTGCCTAAGATAGTTGGATTGTATTGAGCAGAATTACTATTTGACTGTTGCTTCAAGGAATAGAGTATAAATAGGTATCCATCCCAAACAACCTA
AACTTGCCTCTTTATTCAATAGTAATTTCGCTTTTCACTTACGTTATGCGGAGTAGTGGAAAATGATATCATGGATTCTGGATTGCGCAAAGATATGCAGTTCACTGCTGAAAACTCACC
AAACTTACCATAGTTAGAGTTAAGAGTCAATATATTCACTCATCTTTGGCTTAGAATAGAACAGATCATACCTAATTACAATCAGACTCTTCTAGATTAAGCTGTCTAAATAGTGAAAAC
AAATCACAGCACTCAAGAGAAGTTATAATGACAGTGATATGAAAGGAAAAGTGGTGTCTTTTAGCTTTGTAGAATAGAATTGATGTAGTCCTAATCTAAATCATTGTGTTTTTAGAAGTC
ATAATTGAAAATTAAGCTTTAGATGTACATGTTTGTCTTTTTATGCAACATTAATGTTACAATCAAGATTCCATCAAATATTTTCTACAGCAAATGGGTATAGCTCAATGGGCATAAGTG
TACATGGTTAGTTCAAAACAATTCCATTTATTTTTATTAAGTTGATTTTCCATTTATTAGTTGAAGTTACAATTGCAAGGAAGTAATACTCTCTAGGGGCGTTTGACCTAAAAAGTTGAA
AGGAGAATAAGTTGAGGGGAGTGGACGCCTCAACCTTGCTCCTTTTTTGACACAAAATTACGTGGATTTCGTCATTAAAAAACATTTATTTTATATCTAAATTAACTATTCTTAACCCAA
ATAGATAAATGAATGCAAACTAGAGCAAGAAAATGTAAAATGACAATGAGATTTTGTATTTGTTCCATCTTAATTATTTGGGGGCCAGCCCCAAGTAATTTGTAGGGAAGGAGGTGACAT
CTGAGTAGATGCTTCGCTATCCTAATTCATAAGCTTTAGGGCACATACATACATTGCATAATATGAATCGNNNNNNNNNNNNNNNNNNNNNNNNNNNGCCTATAAGGGTTATTAGCTTTT
GAGATTCTTTGCTTTGCTGTCATTTCCACAACCTCTGTTTCAAACCTTTTTCCCTTTTCATTCCTCTTTGAACAGAATCCCAATTTAAAGTCTCAATTCAAAGTATATTATATTGCGTTT
TTGTCACTTTTCTTTATTCTATTATTCATATTCCCTAAACTCAAAATAACCAAATAAATAAATAACATTTTTTTCACTTCTATTATTTTAATTATGAATTAAACGACTCCAACGTAACAT
GATTGTCAAGTCTTATTAAATATGCATTCTACTCCTGTACTTTTTTTTCTTCTTTAATTTAAATGTGCCTACTAGTACCATAATAAAAACACACACATCGATTTTTGTATTTATTATGGT
GTCTATATTTTATATATTTACCAAAGAAAAAAAAGGCCGAATCTTCAATTTTAATTAATTACATGATAAGAAGTGACAACGAACTGTGGGTCTTTTGTTCGAGGAAAGAAAAACAGAAAA
TCAAACTTTGTTATTATTTTATTTCATTCCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTAGTAAAAAAGTAAATAATAAAGCAAAGCATTTTAAGGGAATTTAAAAGTAAAAATTAATTGACTC
TCAAACACCTAAATTTTTAATTTGAGTATAATAAATAGACCAACATTTCAATTTATGTTTATAGTAGATTTTTACAAACTTTTTAAAAATGAAATAACAAACTCCNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTGAATTTTAAAAACTCAAATACTTAGGACAAAATTTTGTAATATTTGGAAG
TTTAGACACAAATTTAGTAAGAGTTGAAAGATAGGGTTTGTATTTATTTATTATTGTTTTTAAGGAGAAATGTGGAAAAGTTACCTTAGAGGTTAAAGCACAGCTTTTGGAGCGTGAATT
TTACGCGCCAATGGATGTAAGAAAAGGTGTGGCTTTTTTTTGCTAAGTACGACTAAAAAGGGCTCCACTCTTCAGCCTCCACTTCCTCCATTTTGCATGGACGCCACCGCCCACATTCTT
CTTCATTCCTCTTTCTCTCTTTCTCTCTCTTTTGCCGTTTATCTTTTAAGTTTTCTCTCTGTAAAGAAAAAAAAAAATGAATCGAATCCCATTTTCTTAAACATAATTCCTTTTCTCCTA
CTTATCTACCGCTTCTCTCTCTGAATTGAATGATTCTACCATGTGGGTCTTCTCTCTAAACTCCCAACTTTTCTTTTTTTGCTCCTGTTCATGGCTTTCCTCTTCTCTGGTATGGCTCCC
CTTTTTCAAATTCCTTTCTCTTCACTTTTCTGTTCTGAAATTTATTGCTTTTTTCGGTTTTTTATGCACCCTTTTTCTTCTTTTTGAAGTTCGTTTTTTATTTTTGGATCGGTTCTTGAT
TCTGTCTCATAATTGTTGATACTAGTGAGTGTGCTTTCGGTTTTTCGTGGTCCTGAATCCTATCTATTCTGTGTTCCCTTCCGGTTACGATTGTTTTTTTATCCTCTCTGTTTCTACATA
GCAATTTGGTTGGTTCGACGATATACCCTGTCTTTAAATTTGATTTACTTTTCTGTAAGTTTTATATGTTCATCTGGATTTAATGCTCTTATATACGGAGTTGAATCCTTTGTGTTCAGG
GGAAATTCTATTTTTAGTTATGGTTGCTCTCCCTTGAATCTGCGTGGACATTCATCACTTCCCTCGATTTTTTTCTTCTCCCTTTTAGGGTTCAAATCTTTTGTTTGCTACTTTTTAGTC
TGGGCTGGCTACCTTTTCTGTTTAATTCTTTATTTGCTCTTCATGCTTTTCTGTGCGGCTTTCAGTATGAATTCTCCTGTATTCTATTTGGTTCTCACTCCACTGCTTTGTAGTTCATGT
TCTTGATGTTAGACTTTATGTTTTAATTAAAGCTGGCAAGTTGTTTTGCACTGTGTTGTCGACTCTGCTAGTTTTTTTTTAGCTTGATTGCTTTCTTTTTTCTTTTTTGGAAAAAAAATG
AATGAAAAATGATTTAACAAGGAAGCTCTCTTCTATTTTCTTTTCCATCGTTGATTCTCTCACTTGTCACCTCCATAGAGCATCAGTGTATCTATAAACTTAAAATGTTTGCCCCTGGTA
ATTCAGTTGTTCTGTTTCTCTCCCTTGCTGGTTCAATTTTTTTTTATTGGCCAACGATTGCTGTGTTTGTGGCCTACAATTTCAATCCAGAACTCGTGTCTTAACCAATGATTTATGCAC
TACAAATTCTGTTTTACAGTGTTTCCCTTGGGATGTTTGTTCTTTTATATGCTTATACTCAAAATCTCATGTATCTTTTTTGCGTGCCCATTTCCTTCATATCTTTGAATCATCTGCCAT
TAGGGAAGGTATCTTGTCAGCTAAGAGAGTTTCTCTGTTTCATTTATGAACTTCTTGTTTGATTATCAGTAGTACTTGACAATAGTCGTTAGAAATTTTAGGGGAGTGCAATTGAATTTT
AGAGTTGGAGTTTCTAAGTTCTTTCAATTATCTTTTCTATTTTCCGGTAAGGTATCATTTGTTCATTAGTTTCCACATCATTTCTAAGAATTTTTTTGTTTCTTTTCCCATCTTCTTTGT
CAGTTGTTTTGAGGGGATGTGAAAAGATTGAGAAATTGGTTGCTAATATCATTTGTAAATTCAAGAAAACAATTTAAATGAAAAGACATAGCATCTTAGTGCTTTTAGATTTTATTTGCT
GCTACATGATTTCTTACCATATTATACTTGACTTTAATTTTCAGGATGAGTGTACTATCCAAGTTCTATTCTAAGAGGGATATCCAGCAGTGAGGTCAACGGATATGGGAGCCTCAAGTT
CTAAACTAGAGGAAGATAAGGCCCTTCGACTGTGTCGTGAAAGAAAGAAGTTTGTTAAGCAGGCCCTTCATGGAAGATGCTCACTTGCGACAGCCCATGCTGAATACATTCAGTCACTCA
GATGTACAGGGACCGCTCTCAAGATATTTGTACAACCTGAAGGTCCAGTTGAATCACCCTTATACACTTCCACTTTTGCAACCCCTGAGCCCCTTGCCTTCACCGAGAAATCTGCATCTC
AATTTTCATTTCCTTCTCCATCCTTCTCACATCATATGGATGCTGCTGGTAATCTTTCTCCATCACCTTCTCCTCCTGCCTCAAGTCGGTTTCAGGCAAATCATATGCAATTCAGGGGCA
GTTTTGCTCACAAGGTTGAAGAAAAATTGCCCTCGCCTGTTATTGGAACCGTAACCTCATCGGAAACTCCACCTAGTGCCAAACCTCAAACCTCTGAAAGACCTCAAACACTATCATTTG
AAGGCTCTTCTGCACCTCAGGAAGGAACTTGGGATTTCTTTTTTCCTTCAAATAATCATGAATTTTCCTTTCATGATGGGCATGAGGTGAATAATGGAGGGGTTGAGTTTGAGAATGCTG
ATGGTGCAAAATACTTCAAGGAAGAGGATGGAAATTTTGAATATGGAGATAAAGAAGGGAAGAGCTCTTTACATGGAGGGGAGGAATCTCAGAACTCGGAGGATGAGTTTGATGAACCTG
CTTCTGAAACTTTGGTTCGAAGTTTTGAAAATTTTAACAGGGTACATGATGATGGAGCATCAAATACTTCTCCTAATATGCATACTGTGAAAAGTGTAGCTTCAGAACCTGAGTTAGTGA
ATCAGGGGAAGAACCATTCTCCTGGTTTGTCACCTTTAAGAACCACATCTTCATTAGTTCCATTAACAACTGTTTTTGGTAAAGCAACTGCAAAGGAAGAGAGCGTGGAGAATACAGCTG
TTCACAAGGACTTATTTTCAAGCATGAAGGAAATTGAGATTCTCTTTATAAAAGCTTCTGAATCTGGCAAAGAAGTTCCAAGAATGCTTGAAGCAAATAAGTTGCACATACGTCCAATTT
TTCCTGGAAAAGAAAGTAATTTCTTACTCTCTCCCTTACCCTGTTCTTCTATGTGTGGTGCTCACATTAATCTCAAAGCTTTGAGCTTAAGGTGAACTTCATAGATTTTCCTGTAATTTC
TTAATTAATAATATGATTTATCCCATAAACAAGAAAGGTATCAGGAATTTACCTAATGGGGTGATGGTGCTTCATGATTTGTCATGGTTCTTTCATTATTTCAACGTTGCAGTTAAATTT
TTTGGAGTAATTGTGTAGTGATCAGCTAGGTAGCCTATCACTGACTTTGTAATTTCTTTTAAAGAATTTAGATGTCCAAAAGGTTTTTTTTCTTTATCTCGTGAGTTGTGAATATCATGC
AGAAATATCTTAACTGGTTTGGTTTTCCACCTGTGCAGATCCATCATTATCGTCAACATTGTTGAAGTCTTGCTTTTCGTGTGGAGATGACCCGGGTGTTGTTCGTGAAGGTATAGGCAC
CTTTGTTGGTTTGTTCTTTATATATTACGAATCAAGTCTGTATATGAATTACCTAGCCTTTTCAGTTGATCTGGGGGGTCCAAACTCACTTTATCAGTTAAACTCATGAGGTGACAAAAC
CTGTCAATGTTTATTTGATGAAATGTTTGAACTCCCAATGTTGATGACTTCCTAAACATTATTTCACATGTCTATAGAAGTCTATAACTAGAATTGAGTGGGATCCATCTTAATTATGGT
AGATGTTAAAGTATAAATTAAAATTAGGATAAATGGAACTCGTGGTTCGGTTTAATGTCTCCTTGTGGCCTGTGGGTGTCAATTACTAGGTCTTTCTGTAATTATGTTTNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATATAACTTTTTACAAACGTGTGTGTGTATATA
TGGCTTTAGGTGAAGGCTTAGGTTACAATATGTATTAGAAGTAAGTGGTAACATCCTACTAATCAATTCTTAAAACCTAAACAAATGAAACCAGAATATTTGCTGTATTTGAGTGAAAAT
TGAAATGCCTTCTCAATCGGTGTGCGTTTGTGTGTTTTCCCTTCCTTCCAAGTTCAGCTTTACATGAATAAGGAGACTTGGGCTTTGTCATTTTCTCATTTTTCATCATAATTACTTAAG
ACGTTCTCAGTGAGAGGAACATATTATTGATTTATTGTTGAGTTATGTTCGTTGTTTCTGAAAATGCTTTTTGCTACACATGATGGGCTGAAAGTACAACAAACAAGTTTTTATGTCTTA
ATTAGTTTTCTGGTTGAATGGGCATATGAAACTATGTGCTGCAACGAAAGCTGCCTACTTCTCATTCTTTCATGCCTTTGAAACATGCTAGTCCTGTTTCCACTAACTTCATTGAGATGC
ATGTGTAACTCAGTTGAAATATTTTATGAGGCCACACTTCTGTATTGATAAGCTGTGGCTGGATGATAGTTGAAGTTGATATCCAATCTCTTCTCTGGAACTATTCACTATGATATCTTC
ATTAATCAGTTGTCGTTTTTTGTCCTATCTTAGAGCCTGTCCAAACTGCAACGAAGTACTTGACTTGGCATAGGACGGCATCCTCACGTTCCTCTTCATCCAGGAATCCTTTGGGAGTTA
ACTCAAAAGAGGATGTTGAGGACTACTCTAGCAACTTATTCGAGAACTTCTGCATGAACTCTGGTAGTCATGCCTCAACCTTGGATAGGCTTTATGCATGGGAAAAGAAGCTCTATGATG
AAGTTAAGGTACTGCCGATGATTATCCGTTTAATCATTTCTGCTATTTTATGCATATTTAGATTTCCGAAATTTGTCACATCACATGTCAAGGCAAGTCTTTAAAATAGGTTTTGCTTTG
TTAATTACAGGCTAGTGAGATGGTCAGGAAAGAGTATGACCTCAAGTGTAAAATGCTACGTCATTTAGAATCAAAGGAAGTCGGTCTACCAAAAATAGACAAAACACGAGCTGTTATCAA
GGATTTACATTCCAGAATCAGAGTGGGAGTTCATAGAATAGATTCTATATCAAAGAAGATTGAAGAATTGCGAGATAGAGAGCTCCAACCGCAACTCGAGGAATTGATTGAAGGGTTAGG
TCCTTTTTTGCTGTCATCATGCTTTGTTTTTTTTTTTTACCACAGATTGATTAGAATATGCAGATTCTTTGTTTGTTGCATCTTATTGGTGATAATTAAGTTATCTTGATATGTTGTCAT
AATGATTAGGTTAAGTCGGATGTGGGAAGTGATGTTTGATTGCCACAAGCATCAACTACAAATCATCAAAGCAGCATCGTACCACGGCAACATGAAAATCTCGATGCACTCTGAAACAAG
GAGGTACAACACCATTTATCTCGAAACCGAACTAGCATCTTTATCATCAAGTTTTATGAAGTGGATTACAGCACAGAAGTCGTATCTGCATTCGATAGATGGATGGCTTCTCAAATGTGT
TACTCTACCTCAACCCAAGGGGAAAAGGAGAGTACAGGCTCCACCCATAAAAAATTATGGACCACCCCCTATATACATTACATGTAGTGTGTGGTTGGAAAAGATCAAGGAATTACCAAC
AAAGGAGGTCGTAGATTCGATAAAGGATTTGGCAGCTGAAACTGCCCGTTTTTTGCCGCATCAGGAGAAAAACCCAAGGAAGGGGAAGGTTGCAAAAAATCTTTCAATCTTAACATCATT
TAAGGGTGACAATGACAGTGAGTCAATAGGGAATAATTTGTTACAAGGGGAAGCATCAGAGAGCTTGATCTCTGGTTTTGATCATTTGAGACCAAGCTTGGTTAAGTTTTTTGAGAAATT
GAATAACTTTGCAGATTCTTCTGTGAAAATGTATGAAGAACTTGGGAAGACCATTCAAGAATTTAAGAGTCATTACGAACAGTGGAAAGCCCAGAGACTGGAGAAACAAGCGGGAATCTG
AGTATGAAGAAGAAAATGGGAAGGAAAAGGTAAGAGGGATTTGTATATGAGAAACAAAATAAAGAAGGCTGTTCTATGTCTTACCGAAACCTGGAAGCAGAAAATAAAGGAGAAGCTGAT
GCAAAACAAGCACATATAAATATAAAAGTACATATATGAAGATAAGAAGATTGATGTTGGAAGGTGTAATTACGAGTGTTTTACATTTACACGTCAAAATAGAATCAATTTGCAGAGTTA
ATATTAGGGGGCATTGTACAGTTCTATTTCTCCATATAAAACACAATGACACACCTTCTCTATCTTGTTCTAGTTCATTCATATGAAACTTCATCACATCATTCATTCTCATTATATTGT
TGGGTAATCTGTTCTCTCTTCTATGAATGAACTTGAATTTTGTCTTGTTTCTTCAGGGATCAAAAGTCCAACCATTATTGTTTTCTAACGAGTGTTTCATAGTGTTTTAAATTAAATAAA
TATTCATCACTTTCTAGCAACTATATGATTTCATTTAATTATTGTATTATACACCATAGTTTTATTGGATTTGCGTTGTATTGAAATATCTTCCCCGTTTCTTGTCTGCACGTAGGCAGC
ATCTCCTTTCTTAATTCAATATATATTTCCATCTACTTAACTTTAATATATAGCAAATAAACATCAAACTCCTTATAATTCATTTAATTTTTTTACTTTACTTTATATCACTCTTAATTT
TTAAACTTTTTTTTTGTAAATAACGAAGATAAATTGTAAATGGACAATTTCGTAGATACAAACCATTAAACGTATCATAAATTACCTTTTTGTCTTCTAAAAAATTCTTGCAATTGTATT
ATTTTTATTTTTTTTCATCTTATTTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNTTTCCTAATAATTTGGTACATTTCAAATATCAGAAAGTATTTTTTATAGTTTCACTCACATTGAAAAATATTGAAATATTAGGAAGAAAAAAAAAAGGAAAAGCAAAATTTGGTA
TCCTAACAATTAAACTTGAGAGCCTCAAACTAAATTTAAGAGAAAGGAAATTACGGAAAAGACTCCTCATGCAATCCCACACACGAGCACGCACGTAATTCTGTTCCTTTTTATNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTTTAACAATTGAATGTTGAAAAAGGGAAAATAACGAACCTGGATGGGTACAGATAGTGTTTTTCTACCACA
GCTTCATGCTATGATCACACTTCTCCTCCATCACTTTCGTCTTCCCCATTTCCTTCTTCACCAATATCTTGCATGTTACTTTTGCCCTAATCCTCCATCTCATCTCCATCCAGTACAACT
TCATCTTCATTGGACCTCTCACATCCACCTTCATTCTCAGTGTTTTCCCTTCCTTCTCCCAATCCTCAAATGCTTTACCCGTACTACTCGATAATCTGATACCAGATCCTTTCACCTTTA
CTCTCATTACCGTCACGTTCCTCGGTGGCTGGTACAACAACGGCAATGCACCTTCGCACAGCATCACATCCGATAAATTCATGGAGACGGTGCTGTTTTTCTCGTAGTAGATTCCGATAT
TTTTGTTGTGGTTTTCTGCTCGTATTGTGACATTGAATTGGGGAGAGAATGAGGTGGTGTTTGGTTTGATTCTGCTGATGGATACAGCGAGAATGGAGAAGCGAGGAAGGTCAGGTTNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGGTGGTGGTGGCGAGTGTAGAGGTTGAAGCGGG
CGGCGTTTTCAGGAGGAGGAATTCGGTAGACTTGGTCTTTGGGGATTTGGATGACGTAGGTAGCAGAAGGAGGGCTTTTGAGCGGATTATTAGAAGCGGAATCAGGGTTAAGAGTGGGGT
GAACACGGTCGGCCATGGAAGATCAAACACAGTATAGAACAGAAATGGAGGAATGAGAAGGGAGAAGAGGAAGGGCGTAAAAGAGAGAGAAGGAAGTAAGAGGTGAGGCACTGTTTTGCT
ACTCTGTTTTTGTTTTCTACGTCCTTTTTTTTTATCATGACGTGAGGTCGTGACTGCATCGCCTTCTTTTAAAAATATAAATGATAAGGATATTCTTTCATAACTTCACAACTAACGTTT
TTTCTTTTTTTTTCAATTTTAATTTTATTCTCTTGTACAAAAACAATTAGAACTATTTAACAGTTTTTACTATTCACTCACTAATTCCTTTTTTTTTTTTTTCATTTATACATAAATAGA
GTTTTTTAGCTCAAAAGTAAGAATGTGACGTCTTCTTAGTTTTTACTCACCTGCAAGGAAATCAAGTTTTTAATATTATATTAAATGATCAAATGACTCGTTAATTAAATTTAAAAATAT
GTGGTGTGTTCTCTACAAGCCGTCAATAAGGCTCAATAATTAATGAAATTAAAATAGAAATATAGTTGAATTATGTGATATGTTATGCTCATACATATATTTAACTTGGTGATATTGAGA
CAAGGCAGCTTCTTTTGTGCTTTAAGAAAGACTGAATATGTATCATTGTGGCAAACTTCAGAAGGTTCAATTTGTTTGCCCATGGTTCAATGTTGTAGAAACCCAAAAGAACATTCTAAA
AGTAATCGAACTAATTTAGGAATCTGAGAAATCATTGAAGTTAAAAAGCCATGATTTGATGCCCTAATCTAGGTCATCCAGGGCCACAAAGAAGAATAAAAAAGTTGAAGACAGTAGGCA
CCAATTAGTAGGCTTAGATTAAAGCAGAGAATAAAAGAAGACATATATCAAGTCTCTGCTCTGCCAAGGGAGGCAGGCAGTCCAAAGCCCGCAGCAAGGTGACCCCCACTATACGATTAT
GCTGCTTAGTTTTAGAGGATAATAAAATCAAAGTGCCCCCTCTTCGCCTTGCTGGCTTCTTCTATATATATACTAAAAACAAAGCCAAAGCCAGGCCAGCATCATCATAAAATAAAAATC
AAAGAGTTTTGAGGTTTGTTTTCTTCTTCAAACACAAACGGATGAAGGATGAAGGACGAAGGAAGGATGAAGGACGAAGGAAGGATGAAGGACGAAGGAAGGATGAAGGACGAAGGGTGC
CATTTGAAACCACAACCACTCCCAGATTCGTACACTAAATAAAAGATCCCCATCTTACTATTGATGGACAACAAAGCCTACTACCATCTTCTGTGCACCAACATTAGATACTAACTTACA
CTACCTTCCTTCAACCCCATCAGCTCCTCAACAGAAGAACATGGAATTGCAAACCTTCTCCTGCAATCTCGGCAGTTGGGGCACAGGAACTGCTCCTGCACTTGTCAGCCCGCCATCGCT
CGAGGCTGTCTCTGATGTTTCTTCAAACTTTATAAACTGCCCAATCTGGGTGGCTGCCAAATGAGCGTAGCAGACGGGAGCAACTGCAAAAATGACATAAGAGCACAATATTAATTAATA
AAGCCACAGGCCAACTTTTTGGGTTTGGTTACACTCTCATGGGCTGGCTATGAACATGGAACATAGACTTACCAACAGAAATCGCTGTAGTACTTCTTTGGTATCTAAACAAACAAAATA
CACAATGATAAGAACAAACATATTATGAACCCGTGTATGAAGAATGTGATTCATTTCCATTAAATATTTACTTACACGTAGGATAGAGAGTGCACTAGTTCTTGCAGGTCATCTGCAGAA
AAACCAACTTCATCTAACAGAACGTGATAATGAGTTGGCCTTGTAGTACCCTTGGAGAGTATAAATGAGAAATGAGATTAGCAACAAAACAAAAGGAATGGTCCTGAAAGAAAGTTACGA
ACACAGTACTCACAATCATTCCAGCATGAGCACAGAGATAGAAATCGTTGTTTCTTGGATGACAAATTTTGTTGTCAATAATAGTTCCTAAACAGAGGGGTCGTCAATGAGTACATTATG
TAGTTCAGAGGTAGAATAATTACAATAACACGCCATAAAGGCAATCTGAATACCGGGAGGAACGTTGTCAGGAGATCCAGGCTGAAAGAACTTAGTGTGATGGTTCTTCTGGGCCACGAT
CACCACAAACTTGGGGTTCCAATTTTCATCAAGGAACTTGCAAGACTATAAACATTTTCAAGAATTAGGATTATCTTATATTTCAAATTGACGAATTATAAAAGATTTCAAGAATTGTTT
AACCACGCTGTTTACAAAACCTGGATAATCTGATCTAATTCAACATTTAGCACTTGGTTAAATTGGGATTCACTGACACCATCCCTGCTCAGAAACAAGCATAAAAGCAACTTTTAGAAG
TATTCAAAATATAGACAGGAAGCTGTGCATTGCTAACAAATAACAAATGTGATATCTCAAACATAAATAGTCATGTTGAACCAAATGTTGTAAGACCATGTAATACCACTGATTAAAGGA
TCCGACCCTCTACTACTGTCCAAACCATAGCATTAGGAGAAATGCTTGCCTGAATATGATAATCTGATCTGGCTTTCTTTTTCCTGAACTAGTATAGAAGTCAAGTAGAAGCTCCCTGAA
AAAGTGAAACCGAACTTCTGAAGTCAACAATGCACAAACCATAAGGCATACAGCAATTGTTTAATGCAGGAAGATGCAGAGATATATACAGTTATTAGTATTTTTCGAATATCTAATTAT
AAGATGTACTTGAAACATAGCTGCCTAACTTGACAAAACTAGGGGACACAGCCCTGGATCCTATTCTCCGCAGACTTTATGTGCTTTAAGCATGAAAAATAGCCAAAAAGTATATTGAAA
AAATTCATAGTGGCTTATAAACCAAGCATCACGAATTCACATTTGCTATTATTATATTTGAAATTTCAAAACCAAGAAATTGTCCGTTAACCTTGGTTTTTAAATTTCACCAAAAATTAT
GGAATAAAGAAACTTTAATGCAATCAGTATACACAGTCGAATGGGGACTCAACATAATACAGCTATATCTTGAGTTCAAGAAGCAAAATAAAGCTATCACCTCATTATTCCATCATCTTC
AGTATCAGAAATACGCTTGTACAAAGAATCAATCATCTCCACTTTTGGAGATTGGGTACGTACTGCAGCTCGGTAACGAGAGATCAATGGCCACTGTCTAGAACTGACCACCTACAGAAT
ATGTAGAAAACCTTTTCAAGAGAATGTTATTGAACAAATTATGGTCAAAGGTATCACCCACAGTTAGATGATATTAGAAGGCATTCTCAGTAAAAGAGAGGCAATAGAGTCATATAATAA
GTATGAAATCAAGCAAGTTACCGCAGCAATAGACGGAATATCTGACTGTCCTGGAGAACCATGTGAAACATCCATACCCAGGATAATTGTTGGAACTTTTGAAACCATAGGAATGGATGG
AGAATGCTCCACTGCTAACAAGGAATTAAGCCCACCAAGCTGCAAAAGATGCGAGAAATTAGCCAGAAACATGCAACATTTAAAAACATGATCACCAGGCACATGGCTTATCCCATGTGC
AAGAAAAAAAGTGAACCAGGGAGAACACAAGATCCCAATAAAATAAACGCAAGACATAGACTTACCTTGGCGTTGATCTTAAGGAGTACATTTGTGAGGTATTGGTCATTTACCCGTGTA
GGAGCAATACACTGAGTAACAATTCCAAATTCTGCAAGATTTTTTTTCTTCCAAGGACCTACGTAATGACAGTAAAATTGTCCACTTCATCCTGGAAAACCATCATATTTAGGGTACCAA
AATAAACTTTACCATAAAGATCAGAATTCTTTCTCTCAGGTAGTAGACAAAGAAGAAATTGTGGTTGTCCAGGAAGTTTAGACTGAACTTCCTCAAACATCTTCTCCACTCTAACCATAG
GTGGGGCACGTCTAAACTGTGGATTTTCTTCAAAAACATCAAAAGGAGCCTCTATTGCCTACACAAACCACCAAAACAGTAACTCGATCAGTATTTATAATTTGTAGCAATGAAGTATCA
ACCTCAGCTAACTTACAATGCCCTTCATATCACCACATTTTATCAGGTCTCTGACAAGGCCACGTGTATCACAGCGCGCTGAGAAGTTCACCACAGCCCATCGCTCTATTTTAGTAGGTT
GAGCCAATTTCTAGCATTCAACAACACTGTAAATTACACAGGATTAATAAGAAATTTACAAAATGAAAGAAACACCAACCTTATTATTGAAATTCCATCGGCCATTACGAGGAAAAAAAT
CTTCCCCATTGCCCACTTTCAACTTCAAAATTGAAAAATTTATCAGATAACTAACAAAATTAAGTGGTCAAGCAGCCAAATAAACTACAATTTTAGAAGCCAAATGCAAGTAATACCTTG
GGTGCAGGTAGAACACGGCCTTCAACTTGAATGAAGCTTGAATTAATAGCAATTCCACATGACCGTAACATCGGCTCAGCATCATATTTGTTCCTTCTCAACGACTGCATCGACCTCAAT
GATTCAGCATAAAGAATGNNNNNNNNNNNNNNNNNNNNNGTTGCATGAGTAAGACAAGACCTACATCGGACAAAACCCTCATCCTTTCTTGTGGCTTTTGCCTCGATTTCTCAACAAGTG
AGGCTCTTTGAAATGTGGACAGTGCTTTTGTGTATCGTTGTAGTGATACCAAAGAGCACAACTGAAAAAGGAAGAGAAGCATTCATGAGCAAGAAAAGCAATCGCTGGCATTATGACCTA
TTCAAATCTAAGAAGGAATAATTAATCCACCTCAACAGGGATAAAAGTGGGACGCTTGGGCTTCCCCACATTTATACAAGGAAGATCTGATGAATATCGAAGTTCGATGTTCCGATGCTT
GACAAAATAATCATAAACAGTGATTTCAATGCAGTCTTCATCATTTCCACCTTTCTGTTTCAAAGTAAACCTATAACATGCACCAAAAATAAAGTTATATATCCAAATAAGAAAGAAGAC
GACGTCTAGGAGTGAAACTAATATCATTATTTATTGGAAATTTTAACTTAAAATGAAAAGGAAATGGCAACTAGATAACAGCAAGAAAACAATACGTTTGCTCTTTACAAGGCTTTTCAC
TTAATCCAGTTATCTTGTATTCTGCATTGGAGGGGCTTGCTTTAATCCTCAAATTCTTGAGTGTCCGTTTAGCCTGTTATTTAATTAAAACTTATGAAAAAAGCTGTAAGGAAATGAAAA
AAAGGTAGCACAGATAAAAACAAATCAGCCGTTGATCACCTTGGTCCAGTCAAGTGAGAAAGGATCTCTGACATTCTGGTTTGCAATTAAAAAGTCCACAACAGGACCAGGCTGTATAAT
CATGGTTGTGGAAACATCTGAAGGGAAAATAATATAGAACCAATTAGACTAATAGTAAATCCAAACATATGAGAACGAGTATGATTGTGAAGACTTACCAATATTCAAAGAGAGGCCACT
CTGTGTTGTTCTAAAACTAGAGTGGAAGCCTCTACAGCCAAGAACTCCACCGCCTACATCAGTACAAGAGTTTGGGTCATTATGGAAAAATGACTGTCTGACAAGTAGGCAACCTCTGCA
GTAAAACGGGTTTGTGTTAGAAAAAGTATCAGAATAATTCAACAATCAGATGCAATAGAGATGATATTTTCTGAATGAGCAAACCCAGAATGTTGTACTTACTGCTTTGATGCATTCTGC
CGTAAGATAATATCCAACACCCTGATGGCCTCTTGGAAATTCTCAGATTCCTGACCACGTAAAGCACTTGCTATAGCCTGCATTGGTATCTTAGCCGCAAAGCTGATTTCTACCTTAAAT
GATTTTGAACGGTAGGGTCGTTTCATCCTTTTTCGGTCTCCATTATTGGGACTTCCATGCCCATCGGGACTACAGTTACCATTGTTCCTGTAGGAATTAAACAATATGATGTAGTGACAA
ACTAACAGGTTTGATTTGAGAGATTTTACTCGAGTAGGTTCAATCATAATGAAGAACAATTATAATTATACCTGTTTGACGTAATATCCTCAAGAACAACAGTAAATTCAAGTTTATTCC
TTGGGAGAGGCCCAACAGTAAACAAACTCTTTTCTCCATCGTAAGCAAAATCTTTACCGGCCAGTTCAGAATTATATGTTTCATGAACCTTGTCGATAACCTTTCTTCCTACGCCCTTGC
CATCAACTGGGCGACCATCTTCATATGCAAGTGCAACCTACAAATTGTGAATGATGTTTAAAAATGAACATGATCATAATCAATCTACCGCTAGCATAAAAATCATTTAAATTCAAAGCA
AAAACGCTGAATATGAATCCAGAGAAACAAAAAATTGATATGAAGATAAGAGGACAGTTATAGAGAAAGGAACGTACACTATAGTGAAAAAAGTGCCCTTCTATATTGGTCACATTCACT
TTAAAATGATTCGTGAGCAGAGATATCTTCTGGCCTTTTGAAGCAAGGCCACGTCGTGCAATTGGAACTCGCACAACCTTTTTTTTCACAATTTCGGGAGCCTGCTCTAGCTCAGCTTGA
ATTGGAACGACATTTGGGGGAATTGGGGGAGGCGGAGGTGGAGGAGGCAACACTGCATCAGCTCCATTTCCATCTGGCTCATTTGAACTCATCCTGAAGTAATTTACGTAATAGTAAGGC
ACAAGACTAGATGAACACGGAACTATTAAGATCAAAAACCCTCAACTCATACTCATACGCCAACCGAACTACCAACAGTAAAATCCAAATTCCCCATTCAGAGCGACGGCAATATAACAA
CGACCTATATAGAACCAGGACATATTCAACACAATGTAAGACTGTATGTAGATAATTGTAATTAACCATAGAAGCCAGTTTCAGAGAACTTCCAAAACAGGCAAACCATGTGAGAAACCT
AATACAAACCAATTACGTTGAGAGAAATTCACCAGACGCACGAAGTATTCCCAGTTACATCAAATTAGAACACCACATGCTTGGATAAATAATGATGACGTTCATAATAATAACACGAGG
GGTCCACTAAAAGTAAAAATCTGTAACAGATATATCATCAAAAGGCACGAAAACGTTAAAAACGAGAACCCATAGTTTCAAAATTAGACAAGAGAATCAAGACGTAGAACAATGAAGCAC
AAAGAAGCTTGACTGACAGCTTAAAGAAACGTCAGCGACAGAAATGTGCATATCATAATTCCTATCCAACGAAGCGGAGCAAAAACATCAACCAGCTGGTCCAACTAGTAAATTAGAACC
CATAAGAACATTGACAATCAGCATGCAAACACACATGCACACAAGCTTTAACAGATAGAACCTACAGTAGTATGGATGATCCACCATCATTTCAAAACAGAGCGCCCACAATAAAAAATA
AGGACAAATTAAAAATTAGATAAATAAATAACGACGTCGCATGTGGACAATCGGCCGAGAAACTTAAAGCATTAACCGATCATCACTAATATTTCTTCGAAAACAAAAACAGAAGAAAGA
AAACCGCAGAAAAATACACAAACTGGTATGATCGGGAAAAGAAAACACTAGTCATTTCCAGAAAAACCGATTCAGGTACGAATTAGAAGAAAACGTTGAAAATACAGCAGTCCCNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGAATCATCTTAAGAAGCTTTTAAGAAGGAAGAATAATCTGGAAGAAAGAGGTGAAATAAAACTAAAAGAGAAGCGCATTGTAG
AGTTGACAGTCGAGAGTAGCCGCATTCTTTCTCAAAATGAAAAGAAGTACGNNNNNNNNNNNNNNNNNNNNNNGCAGAGAAGTGACGAAAAGAATTCAGAAGGCATAAACACATGAGAGA
CAGAGAATGAGGTAAGAGTTAGAAGAATAAAAAAGAAGGAAGCGATGATGAAATCATTACCTTAATCACAGAAGCGAAGAGGAGAGGGAAGAGTGTGAAAACCCTAGAAACTGGAAATAT
GAAGAGTATGAACTATAGCTCAGTTCGAGTCAAACACAATTCATGCTCGCGCTTTCTCTCTCTCTCTCTATATATATATATAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCCCTAAAGTTGCAGCTTTAGCAGCCTTGTTGTGTATGATGTTGAGGGGCTCTTTTGCCCAACTCAGCCCTACCTTCTACGACCAGTCTTGCCCTAATCTTACCGCCGTTGTC
AGAGATACTGTAAGCCAGGCATTGCAGGGTGATGTTCGAGCCGGAGCCAAGCTTGTTCGCTTTCACTTCCATGATTGTTTTGTCAAC
GGTTGTGATGGGTCAGTTTTGTTAGAAAATCAA
GATGGTGTAGAGAGTGAATTAGATGCACCAGGAAACCAAGGAATACAAGGCTTTGACATTGTCGACAGCATCAAAACTGCAGTTGAAGCTTCTTGTCCAAACACTGTGTCTTGTGCAGAT
ATCTTAGCCATTTCAGCCCGTGAATCTGTTGTCTTG
ACAGGAGGGTCAGGTTGGGTAGTCCAATTAGGAAGAAGAGATAGCCAAAATGCAAATAGAACTGGAGCTGAAAACAACCTCCCA
AGCCCTTTTGAAACACTCGATCAACTTCGAGCAAAATTTAATGCAGCTGGGCTCGATTCTACCGATCTTGTGACTTTATCTGGTAATAATTTAACAATTTTA
CTCTATATATATATATAT

Retrieve as FASTA