Entry information : CsaPrx57 (Cucsa.153470.1)
Entry ID 8837
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx57 (Cucsa.153470.1)
Name (synonym) CsaPrx57 (Cucsa.153470.1)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx57
start..stop
S start..stop
PtPrx97 461 3.35e-165 24..333 1..309
MguPrx86 456 8.07e-163 19..333 12..327
MtPrx09 454 6.36e-162 9..333 1..330
NnPrx55 454 7.72e-162 31..332 29..333
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8837' 'complement(join(563982..564403,564850..565012,565125..565307,565625..565858))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 565625..565858 232 N° 2 565125..565307 181 N° 3 564850..565012 161 N° 4 563982..564403 420
complement(join(563982..564403,564850..565012,565125..565307,565625..565858))


exon

Literature and cross-references CsaPrx57 (Cucsa.153470.1)
DNA ref. Phytozome 12:   scaffold01124 (565858..563982)
Protein sequence: CsaPrx57 (Cucsa.153470.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (303)
PWM (Da):   %s   36453.13 (32838.3) Transmb domain:   %s   i13-35o
PI (pH):   %s   5.73 (5.13) Peptide Signal:   %s   cut: 32 range:32-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEIISTSRMKRSFSLVMIMIIFFMICGSTSSQLTVDFYRRSCPNVLRIVRREVINALKNDMRMAASLLRLHFHDCFVSGCDASVLLDGSDGEQNALPNINSLRGLEVMDNIKAVVENSCP
GVVSCADILTIAARDSVLLSGGPAWKVLLGRRDGLVANRTGAEELPSPFESLDGIIKKFIQVGLNVTDVAALSGAHTFGFARCAMFNNRLFNFSGSDSPDPTMESMMVSDLQALCPLTDD
GNKTTVLDRNSTDLFDNHYYKNLLNQKGLLASDQILFSSDEAQTTTKPLVEAYSSNTTLFFSDFVKAMIKMGNMSPLTGSNGQIRNNCGIVNSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATTATCTCAACCAGCAGAATGAAGAGAAGTTTTTCTTTGGTTATGATCATGATAATTTTTTTCATGATTTGTGGTTCCACTAGTTCTCAATTAACTGTAGATTTCTACAGAAGA
TCGTGTCCAAATGTTCTCAGAATCGTGAGGAGAGAAGTCATCAATGCTCTCAAGAACGATATGCGAATGGCTGCTTCCCTTCTTCGCCTCCATTTTCACGACTGCTTTGTTAGC
GTAATT
AAACATGCATTATCATTGCATTTATTAGTTCTTTTCATGATTTTTTAGGAGAATAGTTTCAAATATAACACTCAAACTCAAATTCAAATTCAAAGTATTAGTAGTATATATAACACAATA
AAAAAAATTACAAATATAGTAAAATTTAGATTTAGGTGTTGAAACATCTATCAACTTATTGACCTCTGTTAGGATTAAAGTCTACCGTTAAGAAAAGTGTGTTTATATTTTCCATTCTTG
CTGTATGTTAAATTATTAGCGTTAAAACCGTGATCCATGGCACTTACTAATCTAACACTACAAACGAACAGGGGGTTGCGACGCGTCTGTGCTGTTGGATGGGAGTGATGGGGAGCAAAA
TGCACTTCCCAACATCAATTCTCTGAGAGGGCTTGAAGTTATGGATAACATCAAAGCAGTAGTGGAGAATTCATGTCCGGGAGTTGTATCTTGTGCTGATATATTAACCATAGCTGCCAG
AGATTCTGTTCTCTTG
GTAATTAATCACCAACTCAAGTATATATATGTATAGATATAGTTATAGATATAGCTCTTTTTTTGGGGGGAGGGGGGATTTTAATCAATATTATGGTTGAAATA
TGTTGTAGAGAGCGGAGGACCGGCATGGAAAGTATTATTGGGGAGAAGAGATGGATTGGTAGCGAATAGAACAGGAGCCGAGGAACTTCCTTCTCCATTTGAAAGCCTTGATGGTATCAT
CAAGAAATTCATTCAAGTTGGGCTCAATGTGACTGACGTCGCGGCTTTATCTG
GTGCGTCTATATATTTGTATTATATATTTAACCAAATCATGCATGCATGTTTACAATTTTCGAATTA
TGAAATCTGTTGTAATAACAACTGTTCGTAAATCAATCTTTCTATTATATATCGTGAAAGAAATAAATGAAACGTACGTAAGGGAAAAAAAATGTCACTATAGTGTGAAATAACAAAGAA
GTTAAAAGGAAAGTTTGAGAATCGCATGTTTCATTGATTTTAATGTCATCAGTTAAATGTTGAAAGCACACAGCCAATTTTCGTTTGAAGTTAAAGTTTGAGTAATAACCCATTACAACT
CATTTGTTGTTCTTTGAATTGGATCTGAATTCCAATCTTAAAATTATTCAACGTGACATATAAAATGGGATAATTAGATGTAATCCATCAAACCGCTAACTGATCAAGGAATAATATTGG
TTGCATGGCATGCATGCAGGAGAGCTCATACATTTGGATTTGCAAGATGTGCGATGTTCAACAATAGGCTGTTCAACTTCTCAGGAAGTGATTCTCCAGACCCAACCATGGAGTCCATGA
TGGTATCTGATCTTCAAGCTCTCTGCCCTCTCACCGATGACGGCAACAAGACCACTGTTCTCGACCGAAACTCAACCGATTTATTTGACAACCATTACTACAAGAACTTGCTGAACCAAA
AGGGGCTGTTGGCGTCCGACCAGATCCTGTTCTCAAGCGATGAAGCTCAAACCACTACAAAACCGTTGGTCGAAGCTTATAGCTCAAACACTACGCTTTTCTTCAGCGACTTTGTTAAAG
CCATGATCAAGATGGGGAATATGAGCCCACTCACTGGCTCCAATGGACAGATTCGAAACAACTGCGGAATCGTTAATTCCTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATTATCTCAACCAGCAGAATGAAGAGAAGTTTTTCTTTGGTTATGATCATGATAATTTTTTTCATGATTTGTGGTTCCACTAGTTCTCAATTAACTGTAGATTTCTACAGAAGA
TCGTGTCCAAATGTTCTCAGAATCGTGAGGAGAGAAGTCATCAATGCTCTCAAGAACGATATGCGAATGGCTGCTTCCCTTCTTCGCCTCCATTTTCACGACTGCTTTGTTAGC
GGTTGC
GACGCGTCTGTGCTGTTGGATGGGAGTGATGGGGAGCAAAATGCACTTCCCAACATCAATTCTCTGAGAGGGCTTGAAGTTATGGATAACATCAAAGCAGTAGTGGAGAATTCATGTCCG
GGAGTTGTATCTTGTGCTGATATATTAACCATAGCTGCCAGAGATTCTGTTCTCTTG
AGCGGAGGACCGGCATGGAAAGTATTATTGGGGAGAAGAGATGGATTGGTAGCGAATAGAACA
GGAGCCGAGGAACTTCCTTCTCCATTTGAAAGCCTTGATGGTATCATCAAGAAATTCATTCAAGTTGGGCTCAATGTGACTGACGTCGCGGCTTTATCTG
GAGCTCATACATTTGGATTT
GCAAGATGTGCGATGTTCAACAATAGGCTGTTCAACTTCTCAGGAAGTGATTCTCCAGACCCAACCATGGAGTCCATGATGGTATCTGATCTTCAAGCTCTCTGCCCTCTCACCGATGAC
GGCAACAAGACCACTGTTCTCGACCGAAACTCAACCGATTTATTTGACAACCATTACTACAAGAACTTGCTGAACCAAAAGGGGCTGTTGGCGTCCGACCAGATCCTGTTCTCAAGCGAT
GAAGCTCAAACCACTACAAAACCGTTGGTCGAAGCTTATAGCTCAAACACTACGCTTTTCTTCAGCGACTTTGTTAAAGCCATGATCAAGATGGGGAATATGAGCCCACTCACTGGCTCC
AATGGACAGATTCGAAACAACTGCGGAATCGTTAATTCCTCT

Retrieve as FASTA