Entry information : CsaPrx61 ( Cucsa.170030.1)
Entry ID 8839
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2016-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-27 (Achraf Jemmat)
Peroxidase information: CsaPrx61 ( Cucsa.170030.1)
Name (synonym) CsaPrx61 ( Cucsa.170030.1)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx61
start..stop
S start..stop
RcPrx53 459 2e-164 15..324 14..315
GmPrx65 454 5e-162 2..324 12..328
MtPrx19 453 1e-161 5..324 14..327
GhPrx39 451 3e-161 4..324 10..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 308861..309085 225 N° 2 310106..310294 189 N° 3 310445..310607 163 N° 4 310708..311105 398
join(308861..309085,310106..310294,310445..310607,310708..311105)


exon

Literature and cross-references CsaPrx61 ( Cucsa.170030.1)
DNA ref. Phytozome 12:   scaffold01174 (308861..311123)
Protein sequence: CsaPrx61 ( Cucsa.170030.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (294)
PWM (Da):   %s   35719.79 (32372.0)  
PI (pH):   %s   7.66 (6.50) Peptide Signal:   %s   cut: 30 range:30-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIPTMSKWMSLVSIMLLVGVSLRFRSVNGLNMGYYLMSCPFVDPIVKNTVNRALQNDPTLAASLIRMHFHDCFVEGCDGSILIDSTRDNTAEKDSPANLSLRGYEVIDEIKEQLERECPGVVSCADVIAMAARDAVFWDVNT*QAGGPFYEIPKGRKDGSRSRIEDTVNLPSPFLNASQLINTFAQRGFTPQHCAFYIGAHTLGVARCISFKGRLDGNDPLLSPNFGRALSRTCSNGDNALQTFDATPDSFDNVYYNAVSRGAGVLFSDQTLFASPRTRGIVTAYAMNQALFFLDFQQAIIKMGLLDVKEGYRGQVRRNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCAACAATGTCAAAATGGATGAGTTTAGTAAGCATCATGTTGTTGGTGGGAGTGAGTTTAAGGTTTAGAAGTGTAAATGGGTTGAATATGGGATATTACTTGATGAGTTGTCCC
TTTGTTGATCCTATTGTCAAGAACACGGTCAACCGAGCTCTTCAAAATGATCCCACTCTAGCTGCTTCTCTTATCCGAATGCATTTTCATGATTGTTTCGTTGAG
GTAGTCAAACTTTAA
TTTAAATATATGTTTTACTTTTTCTTTCTCTTTTTTTTCTTTATGATCCATGCTTAAAATATTGATGTTAATATCGTTATTGAGTACTAAGTTTATAGCTATATATCAAAGGATAAGATA
TATATATATATATAGCAAAATTCTATCAAATTTTCAAAAGTAACATATTTGACAAAATATCAATCAAAATCTTTTTAATGAAAAATATCAATTTATTATTTTGCATTTTGTACAATGTAT
CAATCAAAATCTTAAACCTTCTTAAGTGTATATCAATTTAGCACGTACCATCCAAATCATATTGTTTGAAGAATATATTTTACGAGATAAATTAATTTTTTGAATTAAATTCTTAAATTA
TCATAAACGAATCACTATTTAGATATTTTAATTATATTAAGCTTTTCGTTGTGAGTGGATATATTTTTACGCATTCATTTTAATTAACATGAATGTGTTGTTTAAAGAGACCTATTCCAA
ACATAACAAAAACCACTATTTCTATCTAAGTGTTCTCAGAAGAACCTTTTTTCAAAATATTTTTCAAAAAGTGTGTCCTACTCATCCAATTAACCCTACAATAATTATAGATGTTAGTTG
ATATGGAGAAATGAGATATATTGAGATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNTATATATATATATGCATGTGTAGGGATGCGATGGGTCAATATTGATTGATTCAACAAGAGACAACACAGCAGAAAAGGACTCTCCTGCTAACCTTAGC
TTACGAGGGTATGAGGTTATTGATGAGATTAAAGAGCAACTTGAACGCGAATGTCCTGGTGTTGTTTCTTGTGCCGACGTTATCGCTATGGCAGCCAGAGATGCAGTCTTTTGG
GTATTT
TTCTTAACATTTTCTAACTCAATCTTGCGGATTTTATATAAGACATACATGCGTACATATATATGTATATGTGATAATTTATATAATCTTCATTTATGGATTATTATTGTTTTTTTGAAA
ATAATTATAATTAAAAAAAATAATGATGTGAACACATAACAGGCAGGAGGTCCATTTTACGAGATACCGAAAGGAAGGAAGGACGGAAGCAGATCAAGAATCGAAGACACTGTTAACTTA
CCTTCTCCTTTCTTAAATGCTTCTCAGCTAATTAATACTTTTGCTCAACGTGGCTTTACTCCTCAAC
AAATGGTTGCACTTTCCGGTAAGTAGATTAAATATACGAAACAATTTAGTTCT
AAATTGACAGTTTAATTAGCATCTAAACACTTACAAGGACAGTCCATATTGTGCTTTTTATATAGGAGCACATACATTGGGAGTGGCAAGATGCATATCATTCAAAGGGAGACTTGACGG
CAACGACCCTCTTCTAAGTCCAAACTTTGGAAGAGCATTGTCAAGAACATGCAGCAATGGAGACAATGCGCTACAAACATTTGATGCCACACCTGACAGCTTCGACAACGTCTATTACAA
TGCGGTGTCGAGAGGCGCTGGAGTTTTGTTTTCGGACCAGACATTGTTCGCTAGCCCTCGTACGAGAGGCATTGTCACAGCCTATGCCATGAACCAAGCCCTGTTCTTCTTGGACTTTCA
ACAAGCCATCATAAAAATGGGGTTACTTGATGTGAAGGAAGGTTATAGAGGCCAAGTTCGTCGCAATTGCCGTAGAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCAACAATGTCAAAATGGATGAGTTTAGTAAGCATCATGTTGTTGGTGGGAGTGAGTTTAAGGTTTAGAAGTGTAAATGGGTTGAATATGGGATATTACTTGATGAGTTGTCCC
TTTGTTGATCCTATTGTCAAGAACACGGTCAACCGAGCTCTTCAAAATGATCCCACTCTAGCTGCTTCTCTTATCCGAATGCATTTTCATGATTGTTTCGTTGAG
GGATGCGATGGGTCA
ATATTGATTGATTCAACAAGAGACAACACAGCAGAAAAGGACTCTCCTGCTAACCTTAGCTTACGAGGGTATGAGGTTATTGATGAGATTAAAGAGCAACTTGAACGCGAATGTCCTGGT
GTTGTTTCTTGTGCCGACGTTATCGCTATGGCAGCCAGAGATGCAGTCTTTTGG
GATGTGAACACATAACAGGCAGGAGGTCCATTTTACGAGATACCGAAAGGAAGGAAGGACGGAAGC
AGATCAAGAATCGAAGACACTGTTAACTTACCTTCTCCTTTCTTAAATGCTTCTCAGCTAATTAATACTTTTGCTCAACGTGGCTTTACTCCTCAAC
ATTGTGCTTTTTATATAGGAGCA
CATACATTGGGAGTGGCAAGATGCATATCATTCAAAGGGAGACTTGACGGCAACGACCCTCTTCTAAGTCCAAACTTTGGAAGAGCATTGTCAAGAACATGCAGCAATGGAGACAATGCG
CTACAAACATTTGATGCCACACCTGACAGCTTCGACAACGTCTATTACAATGCGGTGTCGAGAGGCGCTGGAGTTTTGTTTTCGGACCAGACATTGTTCGCTAGCCCTCGTACGAGAGGC
ATTGTCACAGCCTATGCCATGAACCAAGCCCTGTTCTTCTTGGACTTTCAACAAGCCATCATAAAAATGGGGTTACTTGATGTGAAGGAAGGTTATAGAGGCCAAGTTCGTCGCAATTGC
CGTAGAGTTAATTAA

Retrieve as FASTA