Entry information : CsaPrx62 (Cucsa.195750.1)
Entry ID 8840
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2014-01-09 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-01-09 (Qiang Li)
Peroxidase information: CsaPrx62 (Cucsa.195750.1)
Name (synonym) CsaPrx62 (Cucsa.195750.1)
Class Class III peroxidase    [Orthogroup: Prx035]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx62
start..stop
S start..stop
CsaPrx104 508 0 1..314 1..315
GmPrx89 457 1.18e-163 3..314 4..319
AtrPrx26 454 2.43e-162 12..314 13..315
GmPrx34 447 7.18e-160 3..314 4..319
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8840' 'join(88712..88916,89378..89570,89975..90517)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 88712..88916 203 N° 2 89378..89570 191 N° 3 89975..90517 541  
join(88712..88916,89378..89570,89975..90517)


exon

Literature and cross-references CsaPrx62 (Cucsa.195750.1)
DNA ref. Phytozome 12:   scaffold01352 (88712..90779)
Protein sequence: CsaPrx62 (Cucsa.195750.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (293)
PWM (Da):   %s   33873.88 (31660.7)  
PI (pH):   %s   8.39 (8.39) Peptide Signal:   %s   cut: 22 range:22-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASIISHLFIVLSLLAFSVNGQLSSGFYSKSCPRLESIVRAGMTKAVNKEKRIGASILRLFFHDCFVNGCDASILLDDTPTARGEKNAFPNRNSARGFEVIDDIKTQVEAACNATVSCAD
ILALATRDGVVLLGGPNWAVPLGRKDSRTASESGANNNLPGPSSSLSTLISMFNAQGFTPREMTTLSGAHTIGMGQCQFFRTRIYNETNIDATFATQRQANCPFNGGDSNLAPLDSTNTM
FDNKYYVDLTNKRGLFHSDQELFNGGSQDALVTTYSKNPNLFKSDFIKAMIKMGNLGPPSGTVTEIRKNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTATTATTTCTCATCTTTTCATTGTTCTTTCTCTTTTAGCTTTTTCTGTCAATGGGCAACTCTCCTCTGGCTTCTACTCCAAAAGTTGTCCTAGACTTGAATCTATTGTTCGT
GCTGGTATGACTAAAGCTGTTAACAAAGAAAAACGTATTGGAGCTTCCATCCTTCGTTTGTTCTTCCACGATTGCTTCGTTAATG
TGTACGACGATTAAAACCCTATTTCTGTGTGTGTG
TGTGTTTTTTTTATGAGTTTGTTTTGACTAGTGATTTTGGATGGTGAAGACAAGATTTTGTTTTTATTTTTGTAGTACATATTTAGGTTTGTTGTTTTTTTAAAAAGAAACTTTCTTATT
ATAGTTTACTTTTTAAAAAATAATAATAATTTGAATTTTTAGTTAAACTTTTTAAGGAAGAATTTTTTTTAAAAAAAACATATACAAATTTCTTAATTTTTGAATTTGGGTTTGGATATA
AAAATATTGATAGCAAGCATATAAAAAATACAAATAAATATATAAGTGGAAAAGTACTATTTTTAAAATAAAAATGAATAACAGAATTGTAAACAAATAAGACTATATATATAAAAAAGA
ATAGGTTAAATGAATCAGACACATGTGCTTGAAAGTGTATGGATTCCTAATATCTTTTTTTAATACAGGGTTGTGATGCTTCTATACTGCTTGATGATACTCCAACAGCTAGAGGTGAAA
AAAATGCATTTCCAAATAGAAACTCGGCTAGAGGGTTCGAAGTAATTGACGACATTAAAACTCAAGTGGAAGCTGCTTGCAATGCAACAGTTTCATGTGCTGATATTCTTGCTCTAGCCA
CGCGTGATGGAGTCGTTTTGG
GGTACTATTCATATCTTTATTTTTTAATTTTGAACGTACCCTTTATATATATATATATAGCAAACTGTTTTATGTAAGATAAGATTACGACTATTTTTG
TTTATTAAATTGAAAAAGTATTTTTAATAAAAAAAAATAGTTATATATTTTTTGAAATGTTTAATATATTGTTGACCTTTTCTTTATTATTTTTCATGCAATATATGGATAGAATAAGAG
AAAATAATACTATTTTGTACATTCTACAAAGAAAGAAGCGATTGTATAATTTTGTCAATAATGCCCGACGAAAACAATTTATTATAAACCAAGATGTGTTTTGTAATTTTTTAGAAATGT
GATTTTGTAACAACTCGCAATTAACGGTTTTTTATCCATCTTACAAAATTTAATTTGTAGCTTGGAGGACCAAATTGGGCTGTACCACTTGGTCGAAAGGACTCGAGGACAGCGAGCGAG
AGCGGAGCAAACAACAACCTTCCAGGACCATCCTCTAGCCTCTCAACACTAATATCAATGTTTAACGCTCAAGGCTTCACCCCCCGTGAAATGACAACCCTCTCGGGTGCTCACACCATA
GGCATGGGCCAATGTCAATTCTTCCGAACTCGCATCTACAATGAAACCAATATTGATGCCACCTTCGCCACCCAGAGGCAAGCCAACTGCCCATTTAACGGTGGTGACAGCAACTTAGCC
CCTCTTGACTCAACCAATACCATGTTTGACAACAAATATTACGTTGACTTAACTAATAAGCGTGGTTTGTTTCATTCGGACCAAGAACTCTTCAATGGTGGTTCACAAGATGCGTTGGTT
ACGACCTACAGTAAAAATCCCAATCTCTTCAAATCGGATTTTATAAAGGCGATGATCAAAATGGGAAATCTTGGTCCTCCAAGTGGAACAGTCACTGAGATAAGAAAAAATTGTAGGGTG
GTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTATTATTTCTCATCTTTTCATTGTTCTTTCTCTTTTAGCTTTTTCTGTCAATGGGCAACTCTCCTCTGGCTTCTACTCCAAAAGTTGTCCTAGACTTGAATCTATTGTTCGT
GCTGGTATGACTAAAGCTGTTAACAAAGAAAAACGTATTGGAGCTTCCATCCTTCGTTTGTTCTTCCACGATTGCTTCGTTAATG
GGTTGTGATGCTTCTATACTGCTTGATGATACTCC
AACAGCTAGAGGTGAAAAAAATGCATTTCCAAATAGAAACTCGGCTAGAGGGTTCGAAGTAATTGACGACATTAAAACTCAAGTGGAAGCTGCTTGCAATGCAACAGTTTCATGTGCTGA
TATTCTTGCTCTAGCCACGCGTGATGGAGTCGTTTTGG
GACCAAATTGGGCTGTACCACTTGGTCGAAAGGACTCGAGGACAGCGAGCGAGAGCGGAGCAAACAACAACCTTCCAGGACC
ATCCTCTAGCCTCTCAACACTAATATCAATGTTTAACGCTCAAGGCTTCACCCCCCGTGAAATGACAACCCTCTCGGGTGCTCACACCATAGGCATGGGCCAATGTCAATTCTTCCGAAC
TCGCATCTACAATGAAACCAATATTGATGCCACCTTCGCCACCCAGAGGCAAGCCAACTGCCCATTTAACGGTGGTGACAGCAACTTAGCCCCTCTTGACTCAACCAATACCATGTTTGA
CAACAAATATTACGTTGACTTAACTAATAAGCGTGGTTTGTTTCATTCGGACCAAGAACTCTTCAATGGTGGTTCACAAGATGCGTTGGTTACGACCTACAGTAAAAATCCCAATCTCTT
CAAATCGGATTTTATAAAGGCGATGATCAAAATGGGAAATCTTGGTCCTCCAAGTGGAACAGTCACTGAGATAAGAAAAAATTGTAGGGTGGTTAATTAA

Retrieve as FASTA