Entry information : CsaPrx64 (Cucsa.201070.1)
Entry ID 8842
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2014-01-09 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-01-09 (Qiang Li)
Peroxidase information: CsaPrx64 (Cucsa.201070.1)
Name (synonym) CsaPrx64 (Cucsa.201070.1)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx64
start..stop
S start..stop
CclPrx35 564 0 1..340 1..330
RcPrx17 563 0 1..340 1..330
CsPrx10 563 0 1..340 1..330
NtPrx35-1B 556 0 1..340 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11675..11929 255 N° 2 13014..13205 192 N° 3 13326..13491 166 N° 4 13701..14116 416
join(11675..11929,13014..13205,13326..13491,13701..14116)


exon

Literature and cross-references CsaPrx64 (Cucsa.201070.1)
DNA ref. Phytozome 12:   scaffold01374 (11675..14116)
Protein sequence: CsaPrx64 (Cucsa.201070.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (320)
PWM (Da):   %s   37295.87 (34973.7)  
PI (pH):   %s   9.02 (9.02) Peptide Signal:   %s   cut: 23 range:23-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQSMSSFIVFAFLGLASVTFSHKIGGGSYGGNGGGGYYLYPQFYDHSCPRAQEIVKYVVAKAFAKEARIAASLLRLHFHDCFVKGCDGSILLDSSGTLASEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILAIAARDSTVITGGPSWEVPLGRRDSRGASLSGSNNDIPAPNNTFQTILTKFKRQGLDIVDLVALSGSHTIGNSRCTSFRQRLYNQSGNAQPDPSLDPSYAAELRKRCPRSGGDQNLFFLDFVSPIKFDNYYFKNLLAAKGLLNSDEVLLTKNLQSAELVKTYAENSELFFEQFAKSMVKMGNITPLTGSRGEIRKNCRKVNRK

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAATCTATGAGCTCTTTTATTGTATTTGCTTTTCTTGGCTTGGCTTCGGTTACTTTCTCTCACAAGATTGGCGGTGGCAGCTATGGTGGCAATGGCGGTGGCGGCTACTATTTG
TATCCTCAGTTTTATGACCATTCATGTCCAAGAGCTCAAGAGATAGTGAAATACGTAGTGGCTAAGGCTTTTGCAAAGGAAGCTCGTATTGCTGCTTCTTTGCTTAGGCTTCATTTCCAT
GATTGTTTTGTTAAG
GTTATTGCGTAAACTAGAAGTCTCTTTTTTATTAACCCTTAATTATAAACATTTTCACTAAAATTGGATTATTGGTTTTAACTACGACTCTTGTTTTTGGATTGA
AAATTATGAAAATTTTTGAATACATTGTATGTCGTGTGACACCCGTATGTTGCAGAATCTTTATACATTTAAGTAAAATCTTGACATTTTCTTAAAAAGAAAATTTATATAAGAGTGAGA
GCATGGAATTATGTATTGCTCTAAAATTTGAGTTTATTTAACTATGACCATTTATTCGATTTTTTAGAATTCAAGTTAATTTCTAACTTTTTAAATAGGAAGTTGAGAAATTAGGAGGAG
GTAAACACAATTTGTAAAAATAGTAACAAAAAAATTAATGTTTTGTTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCCTAGATTA
TCAAACAATACAAAAATGTAAACTATATGTATATATATATAAAAGCTATGGTTGAGAGGGTCTAGCATTCTCATATTTTAGGAGTATTTAGATTTAGGATAGTAAAAATAGGGTAGTATG
GAGCTGTGAATTCTATTGTTTGTTTAGACCCAAGAAATTTGTGTGAGCCTAACAACTAAAAAACCATCTTCATTAATTCTTTATATTCTGGACTAGAGAGTTGAAACAACATCACCCCAT
AAGATTTTGGGTTTGTATTAAAGTTGAAAATGAATATGTATTTGAAGGAATTAAGATAATTACCATGCTTGCTTGTCCATTATTATATTTGAGAAGGTTTGTTAATAGCTACTGACAAGA
AACAAACTAAAATTTTCAGGGTTGTGATGGTTCAATATTGTTAGATAGCAGTGGGACACTAGCTAGTGAGAAAAGATCAAATCCAAACAGAAACTCTGCTAGAGGATTTGAAGTGATTGA
TGAGATCAAATCTGCTTTGGAGAAAGAATGTCCTCAAACTGTTTCTTGTGCTGATATTTTGGCCATTGCTGCCAGAGACTCCACTGTCATT
GTAACTCATTCTTTTCTTTCTTTTGTTCT
TTTTGCTTTTGCTTTTGCATATAATTTCTGTTTAATTAAGCTTGAGATTGAGTGTTTGTTATAATTTGTTTTGTTTGTATAAATTAAAAAGACTGGAGGACCAAGCTGGGAAGTTCCATT
AGGAAGAAGGGATTCAAGAGGAGCAAGTCTAAGTGGCTCTAATAATGACATTCCTGCTCCTAACAACACTTTCCAAACCATTCTCACCAAGTTCAAGAGACAAGGCCTTGACATAGTTGA
TCTTGTTGCTCTTTCAG
GTAAAATTTATCACTTTTTTCTGCTTCCATATAACAGAAATGAGGCTTGGAATAGTGTGGCAGTAGTCCTTGAGAATTTCACGTTAAAAAGAGATCAAGGGAC
CTCAAGAGACCTCACAATGTTCATAAGATAGATGCCTTAAATTCTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCACTGCAGGTAGCCACACCATT
GGAAACTCCCGATGCACTAGCTTCAGGCAACGTCTTTACAACCAATCTGGCAATGCCCAGCCTGATCCCTCTCTCGATCCATCATACGCTGCCGAGTTGCGGAAACGATGCCCGAGATCA
GGTGGTGACCAGAACCTGTTCTTCCTGGACTTTGTGAGCCCCATCAAGTTTGACAACTACTACTTTAAGAATCTTTTAGCTGCAAAGGGTTTGCTGAACTCAGATGAAGTTCTGTTGACA
AAGAACTTGCAATCAGCAGAATTGGTGAAAACATATGCAGAGAATTCTGAGTTGTTTTTTGAGCAATTTGCAAAGTCTATGGTGAAGATGGGAAACATTACTCCTCTAACTGGCTCAAGA
GGAGAGATCAGAAAGAACTGCAGGAAAGTTAATAGAAAATAG

Retrieve as FASTA