Entry information : CsaPrx68 (Cucsa.217820.1)
Entry ID 8843
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx68 (Cucsa.217820.1)
Name (synonym) CsaPrx68 (Cucsa.217820.1)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx68
start..stop
S start..stop
StPrx28 511 0 11..330 12..331
LePrx06 506 0 10..330 12..332
GhPrx06 506 0 14..330 11..328
MePrx31 503 0 10..330 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 69819..70229 411 N° 2 70348..70510 163 N° 3 71396..71814 419  
join(69819..70229,70348..70510,71396..71814)


exon

Literature and cross-references CsaPrx68 (Cucsa.217820.1)
DNA ref. Phytozome 12:   scaffold01658 (69819..71814)
Protein sequence: CsaPrx68 (Cucsa.217820.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (301)
PWM (Da):   %s   35622.99 (32298.2) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.21 (7.99) Peptide Signal:   %s   cut: 30 range:30-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKLIGFTSMLLPLMSFMIIVLLFTVVNGQGTRIGFYSSSCPQAESIVASTVRSHFQSDPKIAPGLLRMHFHDCFVRGCDASVLLAGSNSERTALPNLSLNGFEVIDDAKSQLEAACPGVVSCADILALAARDSVVLTSGIRWGVPTGRRDGTISVASEANNLPGFTDSIEAQKKQFTDKGLNTQDLVTLVGGHTIGTTQCQFFRYRLFNFTAAGGPDPTMDPAFVTQMQALCPQNGDGTRRVALDTGSVGRFDTTFFSNLRNGRGVLESDQKLWTDASTRTFVQRYLGLRGVLGLTFNLEFGKSMVKMSNIEVKTGNQGEIRKVCSAVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAAACTTATTGGTTTTACGTCAATGCTTCTCCCACTCATGTCGTTTATGATTATTGTGCTGTTATTCACTGTTGTGAACGGTCAAGGCACCCGCATTGGTTTTTACTCCAGCTCT
TGCCCTCAAGCCGAGTCCATTGTTGCATCTACTGTACGATCTCATTTTCAATCTGATCCTAAGATTGCTCCAGGTTTATTGAGAATGCACTTCCACGATTGCTTCGTTCGGGGTTGTGAT
GCCTCTGTGCTCCTTGCTGGCTCTAACAGTGAGAGGACTGCACTACCAAACCTTTCGTTAAATGGGTTCGAAGTGATTGACGATGCTAAATCTCAACTTGAAGCTGCTTGTCCTGGTGTT
GTATCTTGCGCTGACATTCTTGCTCTAGCTGCTCGTGACTCAGTAGTTTTG
GTAAGATATATGCATATGTTCTGTCCTATATATATATATCTAATTTTAATAGTAATGAAAGTTAAAACT
TTTTCTCTCCCACCATGACTTGACAAAGGGTTATTTTGTTTGGATGTAGACAAGTGGAATACGTTGGGGAGTGCCCACAGGACGAAGAGATGGGACAATTTCGGTGGCTTCAGAAGCTAA
CAACTTGCCTGGATTTACAGATTCTATCGAGGCTCAAAAGAAACAATTTACTGATAAAGGTCTCAACACTCAAGACCTTGTCACTCTCGTGG
GTAAGATATATAATCATAAACTTATTTA
TCTTATTCATTAGATTAATCCCTATCTAAATTTATATCACATGTTTGACTTCTAAATTTTTTAAATAGTTTGATAACTTCCTAAATTATAATAGATTCTATTTGTATTCTAAAAAAATTA
TAACTAGTTTACCTAATATCTATAAATTTGAATTTTATGTCAAATTAATACACAAAATTTTAAATTATGTATCATAGGGTTTAGGGTTCAGAAGAGAAACACTATCAAACATAAATTTTC
AAGATGCTATATAAAACACTTTATAAAACTCATGAACCAAGCCATCGACCTTAAAGTGTTACGAAATCGACGAGATTGTGAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTAATGATAGACATAAATTACATAAAAA
TGGACAAATATATATGTAAGTCATTTAGGTTTTGGGGTCATTGTCTCCAAAACCCTGCTAAAATGTGTACATCCTCATACCTAATCGTTTAAAATGTCATTTCAACAAATTTAAGATATT
TCAACGTAACGGAACTTACTAAAAAATATTAGATTGTTTTCTTGTTTTTCGTTCTTTTCATATCGTCCAATTCAGTGACCCAGTATAATCACAACTTGCAACATATGGTCATAGTTCTTT
TATAGAATATTTTGATATATTTTCCCCGGCCCATCTCCTTGCCCTCACATTGTAATGCAAAATATGATGAGTACTATTGCTAAAAACGACGTGAACTATATATAATAAGAAAATAATATT
GATGGATGTTGGAGCAGGTGGACACACAATAGGCACAACACAATGCCAATTTTTCAGATACAGACTCTTCAACTTCACAGCAGCAGGCGGTCCAGATCCAACCATGGACCCAGCCTTCGT
GACTCAAATGCAGGCATTGTGTCCTCAAAACGGAGACGGAACCCGTAGGGTCGCGCTGGACACGGGCAGCGTCGGTCGGTTTGACACAACCTTCTTCTCAAACTTAAGGAACGGACGTGG
GGTTTTGGAGTCGGATCAGAAGCTATGGACTGACGCTTCCACTCGTACTTTTGTACAACGGTATTTGGGTTTGAGAGGCGTTTTGGGTTTGACCTTCAATCTTGAGTTTGGGAAATCTAT
GGTGAAGATGAGTAACATTGAAGTTAAAACTGGAAATCAAGGAGAAATTCGTAAAGTTTGTTCTGCAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAAACTTATTGGTTTTACGTCAATGCTTCTCCCACTCATGTCGTTTATGATTATTGTGCTGTTATTCACTGTTGTGAACGGTCAAGGCACCCGCATTGGTTTTTACTCCAGCTCT
TGCCCTCAAGCCGAGTCCATTGTTGCATCTACTGTACGATCTCATTTTCAATCTGATCCTAAGATTGCTCCAGGTTTATTGAGAATGCACTTCCACGATTGCTTCGTTCGGGGTTGTGAT
GCCTCTGTGCTCCTTGCTGGCTCTAACAGTGAGAGGACTGCACTACCAAACCTTTCGTTAAATGGGTTCGAAGTGATTGACGATGCTAAATCTCAACTTGAAGCTGCTTGTCCTGGTGTT
GTATCTTGCGCTGACATTCTTGCTCTAGCTGCTCGTGACTCAGTAGTTTTG
ACAAGTGGAATACGTTGGGGAGTGCCCACAGGACGAAGAGATGGGACAATTTCGGTGGCTTCAGAAGCT
AACAACTTGCCTGGATTTACAGATTCTATCGAGGCTCAAAAGAAACAATTTACTGATAAAGGTCTCAACACTCAAGACCTTGTCACTCTCGTGG
GTGGACACACAATAGGCACAACACAA
TGCCAATTTTTCAGATACAGACTCTTCAACTTCACAGCAGCAGGCGGTCCAGATCCAACCATGGACCCAGCCTTCGTGACTCAAATGCAGGCATTGTGTCCTCAAAACGGAGACGGAACC
CGTAGGGTCGCGCTGGACACGGGCAGCGTCGGTCGGTTTGACACAACCTTCTTCTCAAACTTAAGGAACGGACGTGGGGTTTTGGAGTCGGATCAGAAGCTATGGACTGACGCTTCCACT
CGTACTTTTGTACAACGGTATTTGGGTTTGAGAGGCGTTTTGGGTTTGACCTTCAATCTTGAGTTTGGGAAATCTATGGTGAAGATGAGTAACATTGAAGTTAAAACTGGAAATCAAGGA
GAAATTCGTAAAGTTTGTTCTGCAGTTAATTAA

Retrieve as FASTA